SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023496 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000023496
Domain Number 1 Region: 101-216
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000133
Family Voltage-gated potassium channels 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023496   Gene: ENSGGOG00000014838   Transcript: ENSGGOT00000028121
Sequence length 531
Comment pep:known_by_projection chromosome:gorGor3.1:15:55776266:55848879:1 gene:ENSGGOG00000014838 transcript:ENSGGOT00000028121 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVAPSFNMTNPQPAIEGGISEVEVISQQVDEETKSIAPVQLVNFAYRDLPLAAVDLSTA
GSQLLSNLDEDYQREGSNWLKPCCGKRAAVWQVFLLSASLNSFLVACVILVVILLTLELL
IDIKLLQFSSAFQFAGVIHWISLVILSVFFSETVLRIVVLGIWDYIENKIEVFDGAVIIL
SLAPMVASTVANGPRSPWDAISLIIMLRIWRVKRVIDAYVLPVKLEMEMVIQQYEKAKII
QDEQLERLTQICQEQGFEIRQLRAHLAQQDLDLAAEREAALQAPHVLSQPRSRFKVVEAG
TWDEETAAESVVEELQPSHEATVKDDMNSYISQYYNGPSSDSGVPEPAVCMVTTAAIDIH
QPNISSDLFSLDMPLKLGGNGTSATSESASRSSVTRAQSDSSQTMGSSMDCSTAREEPSS
EPGPSPLPLPPQQQVEEATVQDLLSSLSEDPCPSQRALDPAPLARPSPAGSAQTSPELEH
RVSLFNQKNQEGFTVFQIRPVIHFQPTVPMLEDKFTSLESKEQKLHRVPEA
Download sequence
Identical sequences G3S5Y9
ENSGGOP00000014483 XP_004056616.1.27298 ENSGGOP00000023496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]