SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023522 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000023522
Domain Number 1 Region: 449-591
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.23e-22
Family MAM domain 0.0008
Further Details:      
 
Domain Number 2 Region: 186-285
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000463
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 3 Region: 116-155
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000011
Family EGF-type module 0.0054
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000023522
Domain Number - Region: 53-91
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0157
Family EGF-type module 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023522   Gene: ENSGGOG00000013715   Transcript: ENSGGOT00000025863
Sequence length 595
Comment pep:known_by_projection chromosome:gorGor3.1:4:115227965:115304125:1 gene:ENSGGOG00000013715 transcript:ENSGGOT00000025863 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFLLALVLVSSLYLQAAAEFDGRWPRQIVSSIGLCRYGGRIDCCWGWARQSWGQCQPVC
QPRCKHGECIGPNKCKCHPGYAGKTCNQDEHIPAPLDQGSEQPLFQPLDHQATSLPSRDL
NECGLKPRPCKHRCMNTYGSYKCYCLNGYMLMPDGSCSSALTCSMANCQYGCDVVKGQIR
CQCPSPGLQLAPDGRTCVDVDECATGRASCPRFRQCVNTFGSYICKCHKGFDLMYIGGKY
QCHDIDECSLGQYQCSSFARCYNIRGSYKCKCKEGYQGDGLTCVYIPKVMIEPSGPIHVP
KGNGTILKGDRGHNNWIPDVGSTWWPPKTPYIPPIITNRPTSKPTTRPTPKPTPIPTPPP
PPPLPTELRTPLPPTTPERPTTRLTTIAPAASTPPGGITVDNRVQTDPQKPRGDVFIPRQ
PSNDLFEIFEIERGVSADDEAKDDPGVLVHSCNFDHGLCGWISEKDNDLHWEPIRDPAGG
QYLTVSAAKAPGGKAARLVLPLGRLMHSGDLCLSFRHKVTGLHSGTLQVFVRKHGAHGAA
LWGRNGGHGWRQTQITLRGADIKSVIFKGEKRRGHTGEIGLDDVSLKKGHCSEER
Download sequence
Identical sequences G3S615
XP_004040282.1.27298 ENSGGOP00000013378 ENSGGOP00000023522

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]