SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023524 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000023524
Domain Number 1 Region: 564-636,756-804
Classification Level Classification E-value
Superfamily EF-hand 6.49e-20
Family Polcalcin 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023524   Gene: ENSGGOG00000013587   Transcript: ENSGGOT00000029507
Sequence length 833
Comment pep:known_by_projection chromosome:gorGor3.1:3:20477854:20532933:-1 gene:ENSGGOG00000013587 transcript:ENSGGOT00000029507 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNMEIGHPHEGKDDLGDKRVIMGTKFPMELGIRVGLGKEDSRCGESPVVSNKCEGRMASP
ETKFPLSKGLEMGLERQNISRTVMQRGSLGVDSVSASQGTKPSLLPGRMGLENESLLAGY
THERIIQPPLGRVCGSSQAVGSRRAALASGPEGVEELVGKPALVMEPRQEMEEESTCVLM
KPNTEIKPPVEVDIGLTQAEGPDETKNTEPQMGLVIEPPQCQFAQQPEQRKEAGNIESGV
EPPDLIRPIYSGKFFDRTPCWPSAGKVIPVGYRVATCLTEKLPRLITPPEAKKYFNFRYP
PAGVERVFYGRANDPQIAPYLTHGIRSKISIPANTLINPQPITTFQQKIKDKKESIYLSN
RRAPLGKSHDQAPGLPKGMDTINTTFGTAVIREYSAKDVVNPPKSYEEVFQEGNEGHDLY
VVSHNDYYAGEAKNRKYNPSSFRRCSVYGVPTPHFNDGRAMAKSLYWLHELQMKRGAKFV
SKRADDFKEKFQHKLGRVLDPIAETMNVPPDCTFGACLRPEEYGVGDLIHNRLPDEYLRG
KDRQRALIAAVRHHLKKVNYQKFDTLLAAFRHYDKKGDGMIDKAELQEACDQANLSLDDK
LLDQLFDYCDVDNDGFINYLEFANFLNWKDKMLLKEYEERVIIKGRKPDCVNPTEANIEE
PEPTLLIKPEDIVLKEAGSTEKTLRTLLRPSDKVSNYYKTTSSEINAIVGAIPSTCYPIC
GVPTIRSDIPAPRIRRISDRTNYGEEGSAYSLLYPTIFAQKGVFERDFFKTRSKEEIAEI
LCNIGVKLSDEEFENVWNLASKKHHRGEVCVENIRNVLDELRHADRIKYKTPM
Download sequence
Identical sequences G3S617
ENSGGOP00000023524 XP_004033760.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]