SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023599 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000023599
Domain Number 1 Region: 26-157
Classification Level Classification E-value
Superfamily L domain-like 2.38e-22
Family Internalin LRR domain 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023599   Gene: ENSGGOG00000014113   Transcript: ENSGGOT00000025038
Sequence length 184
Comment pep:known_by_projection chromosome:gorGor3.1:10:82805490:82894065:-1 gene:ENSGGOG00000014113 transcript:ENSGGOT00000025038 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKKMGEAVARVARKVNETVESGSDTLDLAECKLVSFPIGIYKVLRNVSGQIHLITLANN
ELKSLTSKFMTTFSQLRELHLEGNFLHRLPSEVSALQHLKAIDLSRNQFQDFPEQLTSLP
ALETINLEENEIVDVPVEKLAAMPALRSINLRFNPLNAEVRVIAPPLIKFDMLMSPEGAR
APLP
Download sequence
Identical sequences G3S692
XP_004049586.1.27298 XP_004049588.1.27298 ENSGGOP00000023599 ENSGGOP00000013768

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]