SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023636 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000023636
Domain Number 1 Region: 152-295
Classification Level Classification E-value
Superfamily C-type lectin-like 2.62e-24
Family C-type lectin domain 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023636   Gene: ENSGGOG00000025967   Transcript: ENSGGOT00000025836
Sequence length 296
Comment pep:known_by_projection chromosome:gorGor3.1:19:48083585:48085527:1 gene:ENSGGOG00000025967 transcript:ENSGGOT00000025836 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQAAWLLGALVVPQLLGFGHGARGAEREWEGGWGGAQEEEREREALMLKHLQEALGLPAG
RGDENPAGTVEGKEDWEMEEDQGEEEEEEATPTPSSGPSPSPTPEDIVTYILGRLAGLDA
GLHRDTRDAVQALQEAQGRAEREHGRLEGCLKGLRLGHKCFLLSRDFEAQAAAQARCTAR
GGSLAQPADRQQMEALTRYLRAALAPYNWPVWLGVHDRRAEGLYLFENGQRVSFFAWHRS
PRPELGAQPSASPHPLSPDQPNGGTLENCVAQASDDGSWWDHDCQRRLYYVCEFPF
Download sequence
Identical sequences ENSGGOP00000023905 ENSGGOP00000023636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]