SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023645 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000023645
Domain Number 1 Region: 555-639
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000000133
Family Calmodulin-like 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023645   Gene: ENSGGOG00000023504   Transcript: ENSGGOT00000027438
Sequence length 640
Comment pep:known_by_projection chromosome:gorGor3.1:6:53874054:53945406:1 gene:ENSGGOG00000023504 transcript:ENSGGOT00000027438 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSNPVHGLPFLPGTSFKDSMKTAFHRSQTLGYRNGYAIVRHPTVGIGGDRLQFNQLSQA
ELDELASKAPVLTYGQPKQAPPADFIPAHVAFDKKVLKFDAYFQEDVPMSTEEQYRIRQV
NIYYYLEDDSMSVIEPVVENSGILQGKLIKRQRLAKNDRGDHYHWKDLNRGINITIYGKT
FRVVDCDQFTQVFLESQGIELNPPEKMALDPYTELRKQPLRKYVTPSDFDQLKQFLTFDK
QVLRFYAIWDDTDSMYGECRTYIIHYYLMDDTVEIREVHERNDGRDPFPLLMNRQRMPKV
LVENAKNFPQCVLEISDQEVLEWYTAKDFIVGKSLTILGRSFFIYDCDPFTRRYYKEKFG
ITDLPRIDVSKREPPPVKQELPPYNGFGLVEDSAQNCFALIPKAPKKDVIKMLVNDNKVL
RYLAVLESPIPEDKDRRFVFSYFLATDMISIFEPPVRNSGIIGGKYLGRTKVVKPYSTVD
NPVYYGPSDFFIGAVIEVFGHRFIILDTDEYVLKYMESNAAQYSPEALASIQNHVRKREA
PAPEAESKQTEKDPGVQELEALIDTIQKQLKDHSCKDNIREAFQIYDKEASGYVDRDMFF
KICESLNVPVDDSLVKELIRMCSHGEGKINYYNFVRAFSN
Download sequence
Identical sequences ENSGGOP00000023645 ENSGGOP00000023645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]