SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023649 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000023649
Domain Number 1 Region: 53-312,409-470
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.02e-37
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023649   Gene: ENSGGOG00000023410   Transcript: ENSGGOT00000032288
Sequence length 474
Comment pep:novel chromosome:gorGor3.1:17:94029005:94047463:-1 gene:ENSGGOG00000023410 transcript:ENSGGOT00000032288 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGVRGLSRLLTARRLALAKAWPTVLQTGTRGFQFTVDGNKRASAKVSDSISAQYPVVDH
EFDAVVVGAGGAGLRAAFGLSEAGLNTACVTKLFPTRSHTVAAQXSGINALILLNNNHYQ
FSFYNHLVVRTPVTSLWLSASTSVWWEETAAPSGAGAVIPHGLRTSLWHQTPSGAACGHR
TVWSASSGCVEHTCLVCTARRGMPLRSLRYDTSCFVEYFALDLLMENGECRGVIALCIQD
GSIHRRRAKNTVVATGGSYFSHFNMTEPHVTLGAGLSPLLRAGRMPWNQEAAQADFSFVG
EHGASVTMGCKGRLTVEVTNVQFGDINSEMTVEVLSLEEVLQNESERETHTSASCLSFSD
LWTMETPEVVPKNQTCVFSFSVSVSFLIPGRDENKKXIPVLPTMHYMDGIPTSYEGQVLR
HVNGQDQIVPGLYTCGEAACASAHGVNRLGANSLLDLVVGQACALSIAESCRPG
Download sequence
Identical sequences ENSGGOP00000023649 ENSGGOP00000023649

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]