SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023650 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000023650
Domain Number 1 Region: 14-125
Classification Level Classification E-value
Superfamily HIT-like 4.79e-34
Family HIT (HINT, histidine triad) family of protein kinase-interacting proteins 0.00000197
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023650   Gene: ENSGGOG00000026448   Transcript: ENSGGOT00000024112
Sequence length 126
Comment pep:novel chromosome:gorGor3.1:7:141805636:141806016:-1 gene:ENSGGOG00000026448 transcript:ENSGGOT00000024112 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGEIAKAQVARPGGNTVFGKIICKEIPAKIIFEDDQCLAFHDTSPQAPTHFLLISKKHI
SQISAAEDDDESLLGHLMIVGKKCAADLGLNKGYQMVVNKGSDGGQSVYQVHLHVLGGWQ
MHWPPG
Download sequence
Identical sequences G3S6E3
ENSGGOP00000023650 ENSGGOP00000023650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]