SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023651 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000023651
Domain Number 1 Region: 212-350
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 3.05e-58
Family P-domain of calnexin/calreticulin 0.000000318
Further Details:      
 
Domain Number 2 Region: 52-233
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.9e-50
Family Calnexin/calreticulin 0.000000705
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000023651
Domain Number - Region: 353-397
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000103
Family Calnexin/calreticulin 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023651   Gene: ENSGGOG00000006153   Transcript: ENSGGOT00000028500
Sequence length 562
Comment pep:known_by_projection chromosome:gorGor3.1:4:150443902:150466422:-1 gene:ENSGGOG00000006153 transcript:ENSGGOT00000028500 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRFQAFWLCLGLLFISINAEFMDDDVKTEDFEENSEEIDVNEGELSSEIKYKTPQPIGEV
YFAETFDSGRLAGWVLSKAKKDDMDEEISIYDYEVNFQDGIDCGGAYIKLLADTDDLILE
NFYDKTSYIIMFGPDKCGEDYKLHFIFRHKHPKTGVFEEKHAKPPDVDLKKFFTDRKTHL
YTLVMNPDDTFEVLVDQTVVNKGSLLEDVVPPIKPPKEIEDPNDKKPEEWDERAKIPDPS
AVKPEDWDESEPAQIEDSSVVKPAGWLDDEPKFIPDPNAEKPGDWNEDMDGEWEAPQILN
PACRIGCGEWKPPMIDNPKYKGVWRPPLVDNPNYQGIWSPRKIPNPDYFEDDHPFLLTSF
SALGLELWSMTSDIYFDNFIICSEKEVADHWAADGWRWKIMIANANKPGVLKQLMAAAEG
HPWLWLIYLVTAGVPLALITSFCWPRKVKKKYKDTGYKKTDICIPQTKGVVEQEEKEEKA
ALEKPMDLEEEKKQNDGEMLEKEEESEPEEKSEEEIEIIEGQEESNQSNKSGSEDEMKEA
DESTGSGDGPIKSVRKRRVRKD
Download sequence
Identical sequences ENSGGOP00000023651 ENSGGOP00000006020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]