SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023656 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000023656
Domain Number 1 Region: 73-148
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000000516
Family Splicing factor U2AF subunits 0.0000057
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000023656
Domain Number - Region: 13-38
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000353
Family CCCH zinc finger 0.0071
Further Details:      
 
Domain Number - Region: 150-171
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00122
Family CCCH zinc finger 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023656   Gene: ENSGGOG00000025487   Transcript: ENSGGOT00000028703
Sequence length 193
Comment pep:novel chromosome:gorGor3.1:15:13440388:13440966:1 gene:ENSGGOG00000025487 transcript:ENSGGOT00000028703 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEYPASIFGTEKVNCSFDFKIGACLHGDRCSWLHHKPTFSQTIALLNIYCNPQNASQSA
DGLRCAVSDVEMQEHYDEFFEEVFIELGEKYGEVEEMNVCDNLGDHLVGNVYFKLPREED
AEKAVIDLNNRWFNGQPIHAELSPVTDFRGACCRQYEMGECTRGGFCNFMHLKPISRELR
RELCGQRRKKHRS
Download sequence
Identical sequences ENSGGOP00000023656 ENSGGOP00000023656

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]