SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023669 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000023669
Domain Number 1 Region: 979-1076
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000269
Family Canonical RBD 0.0068
Further Details:      
 
Domain Number 2 Region: 72-109
Classification Level Classification E-value
Superfamily SAP domain 0.00000238
Family SAP domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023669   Gene: ENSGGOG00000007403   Transcript: ENSGGOT00000023121
Sequence length 1290
Comment pep:known_by_projection chromosome:gorGor3.1:14:4048332:4083404:-1 gene:ENSGGOG00000007403 transcript:ENSGGOT00000023121 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWRRKYPRTSGGTRGVLSGNRGVEYGSGRGHLGTFEGRWRKLPKMPEAVGTDPSTSRKMA
ELEEVTLDGKPLQALRVTDLKAALEQRGLAKSGQKSALVKRLKGALMLENLQKHSTPHAA
FQPNSQIGEEMSQNSFIKQYLEKQQELLRQRLEREAREAAELEEASAESEDEMIHPEGVA
SLLPPDFQSSLERPELELSRHSPRKSSSISEEKGDSDDEKPRKGERRSSRVRQARAAKLS
EGSQPAEEEEDQETPSRNLRVRADRNLKNDDEGQKSREAPILKEFKEEGEEMPRVKPEEM
MDERPKTRSQEQEVLERGGRFTRSQEEARKTHLARQQQEKEMKTTSPLEEEEREIKSSQG
LKEKSKSPSPPRLTEDQKKASLVALPEQTASEEETPPPLLTKEASSPPPHPQLHSEEEIE
PMEGPAPPVLIQLSPPNADADTRELLVSQHTVQLVGSLSPLSSPSDTKAESPAEKVPEES
VLPLVQKSTLADYSAQKDLEPESDRSAQPLPLKIEELALAKGITEECLKQPSLEQKEGRR
ASHTLLPSHRLKQSADSSSSRSSSSSSSSSRSRSRSPDSSGSRSHSPLRSKQRDVAQART
HANPRGRPKMGSRSTSESRSRSRSRSRSRSASSNSRKSLSPGVSRDSSTSYTETKDPSSG
QEVATPPVPQLQVCEPKERTSTSSSSVQARRLSQPESAEKHVTQRLQPERGSPKKCEAEE
AEPPAATQPQTSETQTSHLPESERIHHTVEEKEEVTMDTSENRPENDVPEPPMPIADQVS
NDDRPEGSVEDEEKKESSLPKSFKRKISVVWTAATKGVPAGNSDTEGGQPGRKRRWGAST
ATTQKKPSISITTESLKSLIPDIKPLAGQEAVVDLHADDSRISEDETERNGDDGTHDKGL
KICRTVTQVVPAEGQENGQREEEEEEKEPEAEPPVPPQVSVEVALPPPAEHEVKKVTLGD
TLTRRSISQQKSGVSITIDDPVRTAQVPSPPRGKISNIVHISNLVRPFTLGQLKELLGRT
GTLVEEAFWIDKIKSHCFVTYSTVEEAVATRTALHGVKWPQSNPKFLCADYAEQDELDYH
RGLLVERPSETKTEEQGIPRPLHPPPPPPVQPPQHPRAEQREQERAVREQWAEREREMER
RERTRSEREWDRDKVREGPRSRSRSRDRRRKERAKSKEKKSEKKEKAQEEPPAKLLDDLF
RKTKAAPCIYWLPLTDSQIVQKEAERAEREAERERNRQLEREKRREHSGDRDRDRERDRE
RGRERDRRDTKRHSRSRSRSTPVRDRGGRR
Download sequence
Identical sequences ENSGGOP00000023669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]