SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023710 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000023710
Domain Number 1 Region: 204-418
Classification Level Classification E-value
Superfamily SMAD/FHA domain 9.11e-62
Family Interferon regulatory factor 3 (IRF3), transactivation domain 0.0034
Further Details:      
 
Domain Number 2 Region: 7-114
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.9e-40
Family Interferon regulatory factor 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023710   Gene: ENSGGOG00000028251   Transcript: ENSGGOT00000024685
Sequence length 426
Comment pep:known_by_projection chromosome:gorGor3.1:16:76476676:76501041:1 gene:ENSGGOG00000028251 transcript:ENSGGOT00000024685 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCDRNGGRRLRQWLIEQIDSSMYPGLIWENDEKSMFRIPWKHAGKQDYNQEVDASIFKAW
AVFKGKFKEGDKAEPATWKTRLRCALNKSPDFEEVTDRSQLDISEPYKVYRIVPEEEQKC
KLGVATAGCVNEVTEMECGRSEIDELIKEPSVDDYMGMIKRSPSPPEACRSQLLPDWWAQ
QPSTGVPLVTGYTTYDAHHSAFSQMVISFYYGGKLVGQATTTCPEGCRLSLSQPGLPGTK
LYGPEGLELVRFPPADAIPSERQRQVTRKLFGHLERGVLLHSSRQGVFVKRLCQGRVFCS
GNAVVCKGRPNKLERDEVVQVFDTSQFFRELQQFYNSQGRLPDGRVVLCFGEEFPDMAPL
RSKLILVQIEQLYVRQLAEEAGKSCGAGSVMQAPEEPPPDQVFRMFPDVCASHQRSFFRE
NQQITV
Download sequence
Identical sequences G3S6K3
XP_018868405.1.27298 XP_018868406.1.27298 ENSGGOP00000023710 ENSGGOP00000023710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]