SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023795 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000023795
Domain Number 1 Region: 383-476
Classification Level Classification E-value
Superfamily PH domain-like 2.8e-17
Family Pleckstrin-homology domain (PH domain) 0.0055
Further Details:      
 
Domain Number 2 Region: 581-662
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000107
Family Third domain of FERM 0.0067
Further Details:      
 
Domain Number 3 Region: 273-324
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000798
Family Second domain of FERM 0.011
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000023795
Domain Number - Region: 16-92
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00828
Family Ubiquitin-related 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023795   Gene: ENSGGOG00000013875   Transcript: ENSGGOT00000027974
Sequence length 685
Comment pep:known_by_projection chromosome:gorGor3.1:14:33608511:33715597:-1 gene:ENSGGOG00000013875 transcript:ENSGGOT00000027974 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALDGIRMPDGCYADGTWELSVHVTDLNRDVTLRVTGEVHIGGVMLKLVEKLDVKKDWSD
HALWWEKKRTWLLKTHWTLDKYGIQADAKLQFTPQHKLLRLQLPNMKYVKVKVNFSDRVF
KAVSDICKTFNIRHPEELSLLKKPRDPTKKKKKKLDDQSEDEALELEGPLITPGSGSIYS
SPGLYSKTMTPTYDAHDGSPLSPTSAWFGDSALSEGNPGILAVSQPITSPEILAKMFKPQ
ALLDKAKINQGWLDSSRSLMEQDVKENEALLLRFKYYSFFDLNPKYDAIRINQLYEQAKW
AILLEEIECTEEEMMMFAALQYHINKLSIMTSENHLNNSDKEVDEVDAALSDLEITLEGG
KTSTILGDITSIPELADYIKVFKPKKLTLKGYKQYWCTFKDTSISCYKSKEESSGTPAHQ
MNLRGCEVTPDVNISGQKFNIKLLIPVAEGMNEIWLRCDNEKQYAHWMAACRLASKGKTM
ADSSYNLEVQNILSFLKMQHLNPDPQLIPEQITTDITPECLVSPRYLKKYKNKQEINTIK
GLLLRKMVLWYNIKSPLQGNFTWDRSWYSLPPTSCHKRCYRFQGGKKEELIGIAYNRLIR
MDASTGDAIKTWRFSNMKQWNVNWEIKMVTVEFADEVRLSFICTEVDCKVVHEFIGGYIF
LSTRAKDQNESLDEEMFYKLTSGWV
Download sequence
Identical sequences ENSGGOP00000023795 ENSGGOP00000013536

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]