SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023814 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000023814
Domain Number 1 Region: 49-327
Classification Level Classification E-value
Superfamily Thiolase-like 2.99e-59
Family Thiolase-related 0.0000886
Further Details:      
 
Domain Number 2 Region: 333-471
Classification Level Classification E-value
Superfamily Thiolase-like 1.92e-33
Family Thiolase-related 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023814   Gene: ENSGGOG00000025829   Transcript: ENSGGOT00000023857
Sequence length 475
Comment pep:known_by_projection chromosome:gorGor3.1:2a:26677458:26726126:1 gene:ENSGGOG00000025829 transcript:ENSGGOT00000023857 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTILTYPFKNLPTASKWALRFSIRPLSCSSQLRAAPAVQTKTKKTLAKPNIRNVVVVDG
VRTPFLLSGTSYKDLMPHDLARAALTGLLHQTSVPKEVVDYIIFGTVIQEVKTSNVAREA
ALGAGFSDKTPAHTVTMACISANQAMTTGVGLIASGQCDVIVAGGVELMSDVPIRHSRKM
RKLMLDLNKAKSMGQRLSLISKFRFNFLAPELPAVSEFSTSETMGHSADRLAAAFAVSRL
EQDEYALRSHSLAKKAQDEGLLSDVVPFKVPGKDTVTKDNGIRPSSLEQMAKLKPAFIKP
YGTVTAANSSFLTDGASAILIMAEEKALAMGYKPKAYLRDFMYVSQDPKDQLLLGPTYAT
PKVLEKAGLTMNDIDAFEFHEAFSGQILANFKAMDSDWFAENYMGRKTKVGLPPLEKFNN
WGGSLSLGHPFGATGCRLVMAAANRLQKEGGQYGLVAACAAGGQGHAMIVEAYPK
Download sequence
Identical sequences G3S6V7
ENSGGOP00000023814 ENSGGOP00000023814 XP_004029004.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]