SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023840 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000023840
Domain Number 1 Region: 262-330
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000243
Family RING finger domain, C3HC4 0.025
Further Details:      
 
Domain Number 2 Region: 77-98
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000824
Family CCCH zinc finger 0.0053
Further Details:      
 
Domain Number 3 Region: 197-222
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000033
Family CCCH zinc finger 0.0033
Further Details:      
 
Domain Number 4 Region: 46-69
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000536
Family CCCH zinc finger 0.0055
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000023840
Domain Number - Region: 354-383
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00144
Family CCCH zinc finger 0.0045
Further Details:      
 
Domain Number - Region: 143-229
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 0.0458
Family Transhydrogenase domain III (dIII) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023840   Gene: ENSGGOG00000023977   Transcript: ENSGGOT00000022320
Sequence length 471
Comment pep:known_by_projection chromosome:gorGor3.1:7:138799009:138806347:-1 gene:ENSGGOG00000023977 transcript:ENSGGOT00000022320 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RQELYNPGSSGALLCGITSNGEAVAPSPTLVPTVTTPSPGAGSWTKQVTCRYFMHGVCKD
RGNCGYSHDLSDSPYGVVCKYFQQGYCVYGDCCKYEHSKPLKQEEATATELTTKSSLAAS
SSLSSIVGPLVEMNTGEAESRNSNFATVGAGSEDWVNAIEFVPGQPYCGRTAPSCTEAPL
QGSVTKEESEKEQTAVETKKQLCPYAAVGECRYGENCVYLHGDSCDMCGLQVLHPMDAAQ
RSQHIKSCIEAHEKDMELSFAVQRSKDMVCGICMEVVYEKANPSERRFGILSNCNHTYCL
KCIRKWRSAKQFESKIIKSCPECRITSNFVIPSEYWVEEKEEKQKLILKYKEAMSNKACR
YFDEGRGSCPFGGNCFYKHAYPDGRREEPQRQKVGTSSRYRAQRRNHFWELIEERENSNP
FDNDEEEVVTFELGEMLLMLLATGGDDELTDSEDEWDLFHDELEDFYDLDL
Download sequence
Identical sequences ENSGGOP00000023840 ENSGGOP00000023840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]