SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023859 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000023859
Domain Number 1 Region: 122-220
Classification Level Classification E-value
Superfamily EF-hand 1.33e-23
Family EF-hand modules in multidomain proteins 0.0023
Further Details:      
 
Domain Number 2 Region: 8-119
Classification Level Classification E-value
Superfamily EF-hand 8.16e-23
Family EF-hand modules in multidomain proteins 0.0051
Further Details:      
 
Domain Number 3 Region: 203-284
Classification Level Classification E-value
Superfamily RING/U-box 2.24e-19
Family ZZ domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023859   Gene: ENSGGOG00000027242   Transcript: ENSGGOT00000031965
Sequence length 577
Comment pep:known_by_projection chromosome:gorGor3.1:2b:95259539:95327228:-1 gene:ENSGGOG00000027242 transcript:ENSGGOT00000031965 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPDKQDALNSIENSIYKTAFKLRSVQTLCQLDLIDSSLIQQVLLGPSFWEAGKRSLSVQ
QLSQALQELFQKAREENPGQVHPRAPELTLSLLTTMYNSTGTGFLQLMPAAAALTTLSGD
SPLTKYRALFQLCAENSRGGYDSGPRMTRRVLRKLLTDLQQIPTVVGESRALCPVESATC
SYFQGVLSPAVREEKFLSWVQSEPPILLWLPTCHRLSAAERVTHPAWCTVCRTFPITGLR
YRCLKCLNFDICQMCFLSGLHSKSHQKSHPVIEHCIQMSAMQNTKLLFRTLRNNLLQERC
RKKEAARRQQLLDQVNPKGVPHHAQARLLKKQLNQYKDKLQAIYTSQEERSRFETRIHKL
RTNQDSLWTKLQQIRRDLQARLQPPGPSSSSFQNVGNKVDHSSTEKVPKGGDYLQIKNAT
EDASTGEPLPKLDEVDRSHRSHTNAEHALRNPESPETTLHSTRAQSQKQKMPKKVISTLP
SYQEGLKQDIPKMVPAEMSSPALAAVEKKEAGNIKERKDELEEEELQELLSKLMDAFNLK
TPSGPESSVNMDLYSGAQRVCRAFSALVDQIALPNLK
Download sequence
Identical sequences G3S702
ENSGGOP00000019080 ENSGGOP00000023859 XP_004033159.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]