SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023867 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000023867
Domain Number 1 Region: 479-580
Classification Level Classification E-value
Superfamily SpoIIaa-like 6.08e-16
Family Anti-sigma factor antagonist SpoIIaa 0.0047
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000023867
Domain Number - Region: 107-175
Classification Level Classification E-value
Superfamily Dhaf3308-like 0.0641
Family Dhaf3308-like 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023867   Gene: ENSGGOG00000000528   Transcript: ENSGGOT00000022454
Sequence length 594
Comment pep:known_by_projection chromosome:gorGor3.1:5:133826201:133830029:1 gene:ENSGGOG00000000528 transcript:ENSGGOT00000022454 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPVLQWLPKYDLKKNILGDVMSGLIVGILLVPQSIAYSLLAGQEPVYGLYTSFFASIIYF
LLGTSRHISVGIFGVLCLMIGETVDRELQKAGYDNAHSAPSLGMVSNGSTLLNHTSDRIC
DKSCYAIMVGSTVTFIAGVYQVAMGFFQVGFVSVYLSDALLSGFVTGASFTILTSQAKYL
LGLNLPRTNGVGSLITTWIHVFRNIHKTNLCDLITSLLCLLVLLPTKELNEHFKSKLKAP
IPVELVVVVAATLASHFGKLHENYNSSIAGHIPTGFMPPKVPEWNLIPSVAVDAIAISII
GFAITVSLSEMFAKKHGYTVKANQEMYAIGFCNIIPSFFHCFTTSAALAKTLVKESTGCH
TQLSGVVTALVLLLVLLVIAPLFYSLQKSVLGVITIVNLRGALRKFRDLPKMWSISRMDT
VIWFVTMLSSALLSTEIGLLVGVCFSMFCVILRTQKPNSSLLGLVEESEVFESVSAYKNL
QTKPGIKIFRFVAPLYYINKECFKSALYKQTVNPILIKVAWKKAHTIVIDCSAIQFLDTA
GIHTLKEVRRDYEAIGIQVLLAQCNPSVRDSLTNGEYCKKEEENLLFYSVYEAM
Download sequence
Identical sequences ENSGGOP00000023867

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]