SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023897 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000023897
Domain Number 1 Region: 205-250
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000439
Family EGF-type module 0.0057
Further Details:      
 
Domain Number 2 Region: 113-170
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000291
Family Ovomucoid domain III-like 0.0057
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000023897
Domain Number - Region: 8-38
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0659
Family EGF-type module 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023897   Gene: ENSGGOG00000002466   Transcript: ENSGGOT00000030949
Sequence length 317
Comment pep:novel chromosome:gorGor3.1:9:82634800:82714126:1 gene:ENSGGOG00000002466 transcript:ENSGGOT00000030949 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AELNVKESDVRVCDESSCKYGGVCKEDGDGLKCACHFQCFSSFFELCGIHNTFSNYASLM
RSICLRHQVLTPNVKHFFFSDNGSGSGEGEEEGSGAEVHRKHSKCGPCKYKAECDEDAEN
VGCVCNIDCSGYSFNPVCASDGSSYNNPCFVREASCIKQEQIDIRHLGHCTDTDDTSLLG
KKDDGLQYRPDVKDASDQREDVYIGNHMPCPENLNGYCIHGKCEFIYSTQKASCRCESGY
TGQHCEKTDFSILYVVPSRQKLTHVLIAAIIGAVQIAIIVAIVMCITSNRKCPKNNRGRR
QKQNLGHFTSDTSSRMV
Download sequence
Identical sequences ENSGGOP00000023897 ENSGGOP00000002426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]