SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023901 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000023901
Domain Number 1 Region: 2-127
Classification Level Classification E-value
Superfamily SMAD/FHA domain 7.46e-19
Family FHA domain 0.0041
Further Details:      
 
Domain Number 2 Region: 115-184
Classification Level Classification E-value
Superfamily BRCT domain 0.000000000305
Family BRCT domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023901   Gene: ENSGGOG00000027731   Transcript: ENSGGOT00000023512
Sequence length 757
Comment pep:known_by_projection chromosome:gorGor3.1:8:88727643:88779141:-1 gene:ENSGGOG00000027731 transcript:ENSGGOT00000023512 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWKLLPAAGPAGAGEPYRLLTGVEYVVGRKNCAILIENDQSISRNHAVLTANFSVTNLSQ
TDEIPVLTLKDNSKYGTFVNEEKMQNGFSRTLKSGDGITFGVFGSKFRIEYEPLVACSSC
LDVSGKTALNQAILQLGGFTVNNWTEECTHLVMVSVKVTIKTICALICGRPIVKPEYFIE
FLKAVQSKKQPPQIESFYPPLDEPSIGSKNVDLSGRQERKQIFKGKTFIFLNAKQHKKLS
SAVVFGGGEARLITEENEEEHNFFLAPGSCVVDTGITNSQTLIPDCQKKWIQSIMDMLQS
KYCRNIRLGSLLTKLLFMWQKTICFLEGMQYYRLKTTTPGPSLSQGLSVDEKLMPSAPVN
TTTYVADTESEQADTWDLSERPKEIKVSKMEQKFRMFSQDAPTVKESCKTSSNNNSMVSD
TLAKMRIPNYQLSPTKLPSINKSKDRASQQQQTNSIRNYFQPSTKKSLRERDEENQEMSS
CKSARIETSCSLLEQTQPATPSLWKNKEQHLSENEPVDTNSDNNLFTDTDLKSIVKNSAS
KSHAAEKLRSNKKREMDDVAIEDEVLEQLFKDTKPELEIDVKVQKQEEDVNVRKRPRMDI
ETNDTFSDEAVPESSKISQENEIGKKRELKEDSLWSAKEISNNDKLQDDSEMLPKKLLLT
EFRSLVIKNSTSRNPSGINDDYGQLKNFKKFKKVTYPGAGKLPHIIGGSDLIAHHARKNT
ELEEWLRQEMEVQNQHAKEESLADDLFRYNPYLKRRR
Download sequence
Identical sequences ENSGGOP00000023901 ENSGGOP00000023901

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]