SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023923 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000023923
Domain Number - Region: 68-140
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.000589
Family Apolipoprotein A-I 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023923   Gene: ENSGGOG00000003416   Transcript: ENSGGOT00000028274
Sequence length 218
Comment pep:known_by_projection chromosome:gorGor3.1:19:13147289:13168441:-1 gene:ENSGGOG00000003416 transcript:ENSGGOT00000028274 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERQGVDVPHVKCKDQELQPLGESKEHPRWEENCEEEAGGGPASASCQLTVLEGKSGLYF
SSLDSSIDILQKRAQELIENINKSRQKDHALMTNFRNSLKTKVSDLTEKLEERIYQIYND
HNKIIQEKLQEFTQKMAKISHLETELKQVCHSVETVYKDLCLQPEQSLRLRWGPDHSRGK
SPPRPSDSQPPDVFVSSVAETTSQATASEVQTNRDGEC
Download sequence
Identical sequences ENSGGOP00000003355 ENSGGOP00000003355 ENSGGOP00000023923

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]