SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023937 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000023937
Domain Number 1 Region: 1355-1461
Classification Level Classification E-value
Superfamily C-type lectin-like 1.53e-40
Family Noncollagenous (NC1) domain of collagen IV 0.00000383
Further Details:      
 
Domain Number 2 Region: 1462-1576
Classification Level Classification E-value
Superfamily C-type lectin-like 5.18e-40
Family Noncollagenous (NC1) domain of collagen IV 0.00000537
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023937   Gene: ENSGGOG00000000724   Transcript: ENSGGOT00000025841
Sequence length 1578
Comment pep:known_by_projection chromosome:gorGor3.1:2b:116072551:116192692:-1 gene:ENSGGOG00000000724 transcript:ENSGGOT00000025841 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GPTGVPGFPGLDGIPGHPGPPGPRGKPGVSGHNGSRGDPGFPGGRGALGPGGPLGHPGEK
GEKGNTVFILGAVKGIQGDRGDPGLPGLPGSWGAGGPAGPTGYPGEPGLVGPPGQPGRPG
LKGNPGVGVKGQMGDPGEVGQQGSPGPTLLVEPPDFCLYKGEKGIKGIPGMIGLPGPPGR
KGESGIGAKGEKGIPGFPGPRGDPGSYGSPGFPGLKGELGLVGDPGLFGLIGPKGDPGNR
GHPGPPGVLVTPPLPLKGPPGDPGFPGRYGETGDVGPPGPPGLLGRPGEACAGMIGPPGP
QGFPGLPGLPGEAGIPGRPDSAPGKPGKPGSPGLPGAPGLQGLPGSSVIYCSVGNPGPQG
IKGKVGPPGGRGSKGEKGNEGLCACEPGPMGPPGPPGLPGRQGSKGDLGLPGWLGTKGDP
GPPGAEGPPGLQGKHGASGPPGNKGAKGDMVVSRVKGHKGERGPDGPPGFPGQPGSHGRD
GHAGEKGDPGPPGDHEDATPGGKGFPGPLGPPGKAGPVGPPGLGFPGPPGERGYPGVPGH
PGVRGPDGLKGQKGDTISCNVTYPGRHGPPGFDGPPGPKGFPGPQGAPGLSGSDGHKGRP
GTPGTAEIPGPPGFRGDMGDPGFGGEKGSSPVGPPGPPGSPGVNGQKGIPGDPAFGHLGP
PGKRGLSGVPGIKGPRGDPGCPGAEGPAGIPGFPGLKGPKGREGHAGFPGVPGPPGHSCE
RGAPGIPGQPGLPGYPGSPGAPGGKGQPGDVGPPGPAGMKGLPGLPGQPGAHGPPGLPGI
PGPFGDDGLPGPPGPKGPRGLPGFPGFPGERGKPGAEGCPGTKGEPGEKGMSGLPGDQGL
RGAKGAIGPPGDEGEMAIISQKGTPGEPGPPGDDGFPGERGDKGTPGMQGRRGEPGRYGP
PGFHRGEPGEKGQPGPPGPPGPPGSTGLRGFIGFPGLPGDQGEPGSPGPPGFSGIDGARG
PKGNKGDPASHFGPPGPRGEPGSPGCPGHFGAFGEQGLPGIQGPRGSPGRPGPPGSSGPP
GCPGDHGMPGLRGQPGEMGDPGPRGLQGDPGIPGPPGIKGPSGSPGLNGLHGLKGQKGTK
GASGLHDVGPPGPVGIPGLKGERGDPGSPGISPPGPCGEKGPPGPPGRSGPPGPAGATGR
APKDIPDPGPPGDQGPPGPDGPRGAPGPPGLPGSVDLLRGEPGDCGLPGPPGPPGPPGPP
GYKGFPGCDGKDGQKGPMGFPGPQGPHGFPGPPGEKGLPGPPGRKGPTGLPGEPGPPADV
DDCPRIPGLPGAPGMRGPEGAMGLPGMRGPPGPGCKGEPGLDGRRGVDGVPGSPGPPGRK
GDTGEDGYPGGPGPPGPIGDPGPKGFGPGYLGGFLLVLHSQTDQEPTCPLGMPRLWTGYS
LLYLEGQEKAHNQDLGLAGSCLPVFSTLPFAYCNIHQVCHYAQRNDRSYWLASAAPLPMM
PLSEEAIRPYVSRCAVCEAPAQAVAVHSQDQSIPPCPQTWRSLWIGYSFLMHTGAGDQGG
GQALMSPGSCLEDFRAAPFLECQGRQGTCHFFANKYSFWLTTVKADLQFSSAPAPDTLKE
SQAQRQKISRCQVCVKYS
Download sequence
Identical sequences ENSGGOP00000023937

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]