SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023938 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000023938
Domain Number 1 Region: 99-160
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000228
Family Calmodulin-like 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023938   Gene: ENSGGOG00000006667   Transcript: ENSGGOT00000024214
Sequence length 241
Comment pep:known_by_projection chromosome:gorGor3.1:1:15891160:15911660:1 gene:ENSGGOG00000006667 transcript:ENSGGOT00000024214 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATDELATKLSRRLQMEGEGGGETPEQPGLNGAAAAAAGAPDEAAEALGSADCELSAKLL
RRADLNQGIGEPQSPSRRVFNPYTEFXXXXXXXCQDVLSFCICRYDAGRDGFIDLMELKL
MMEKLGAPQTHLGLKNMIKEVDEDFDSKLSFREFLLIFRKAAAGELQEDSGLCVLARLSE
IDVSSEGVKGAKSFFEAKVQAINVSSRFEEEIKAEQEERKKQAEEMKQRKAAFKELQSTF
K
Download sequence
Identical sequences ENSGGOP00000023938 ENSGGOP00000006523

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]