SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023968 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000023968
Domain Number 1 Region: 107-192
Classification Level Classification E-value
Superfamily 6-phosphogluconate dehydrogenase C-terminal domain-like 1.7e-24
Family ProC C-terminal domain-like 0.0018
Further Details:      
 
Domain Number 2 Region: 1-108
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 2.01e-17
Family 6-phosphogluconate dehydrogenase-like, N-terminal domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023968   Gene: ENSGGOG00000014247   Transcript: ENSGGOT00000030125
Sequence length 354
Comment pep:known_by_projection chromosome:gorGor3.1:1:206041130:206077895:-1 gene:ENSGGOG00000014247 transcript:ENSGGOT00000030125 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVGFIGAGQLAYALARGFTAAGILSAHKIIASSPEMNLPTVSALRKMGVNLTCSNKETV
KHSDVLFLAVKPHIIPFILDEIGANVQARHIVVSCAAGVTISSVEKAFMALDALADGGVK
MGLPRRLAIQLGAQALLGAAKMLLDSEQHPCQLKDNVCSPGGATIHALHFLESGGFRSLL
INAVEASCIRTRGGRQVPGVGGQHAPAGVRHGAAAAAQQRTGAGRAAALPAASPQGRAAQ
ARAAVPAQRPGPGDRRVAARPRRRLQPHLPHRLQAGVRPRERLEGLRRDRSRELLAAAEP
APAATAATGVGAEGASGPAGVRRPQAGPLCLAGGASRPWGAPAGAAHPGPWGLW
Download sequence
Identical sequences ENSGGOP00000023968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]