SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000023974 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000023974
Domain Number 1 Region: 2-173
Classification Level Classification E-value
Superfamily PR-1-like 5.36e-52
Family PR-1-like 0.00000478
Further Details:      
 
Domain Number 2 Region: 222-278
Classification Level Classification E-value
Superfamily Crisp domain-like 1.2e-17
Family Crisp domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000023974   Gene: ENSGGOG00000024118   Transcript: ENSGGOT00000024796
Sequence length 278
Comment pep:known_by_projection chromosome:gorGor3.1:6:51249366:51269444:-1 gene:ENSGGOG00000024118 transcript:ENSGGOT00000024796 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALLPVLFLVTVLLPSLPAEGKDPAFTALLTTQLQVQREIVNKHNELRKAVSPPASNMLK
MEWSREVTTNAQRWANKCTLQHSDPEDRKTSTRCGENLYMSSDPTSWSSAIQSWYDESLD
FVYGVGPKSPNAVVGHYTQLVWYSTYQVGCGIAYCPNQDSLKYYYVCQYCPAMKTYLNKR
EGINVWKCFLRLRHFQLLRGEQLLAFSGNNMNRKNTPYQQGTPCASCPDDCDKGLCTNSC
QYQDLLSNCDSLKNTAGCEHELLKEKCKATCLCENKIY
Download sequence
Identical sequences A0A2I2YLF0
ENSGGOP00000023974 ENSGGOP00000023974

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]