SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024026 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024026
Domain Number 1 Region: 404-510
Classification Level Classification E-value
Superfamily Mitochondrial carrier 7.85e-19
Family Mitochondrial carrier 0.0037
Further Details:      
 
Domain Number 2 Region: 102-201
Classification Level Classification E-value
Superfamily EF-hand 0.00000000136
Family Calmodulin-like 0.042
Further Details:      
 
Domain Number 3 Region: 6-134
Classification Level Classification E-value
Superfamily EF-hand 0.000017
Family Calmodulin-like 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024026   Gene: ENSGGOG00000008939   Transcript: ENSGGOT00000027816
Sequence length 655
Comment pep:known_by_projection chromosome:gorGor3.1:2b:59634944:59718827:-1 gene:ENSGGOG00000008939 transcript:ENSGGOT00000027816 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YASTEVDGEHYMTPEDFVQRYLGLYNDPNSNPKIVQLLAGVADQTKDGLVVYGLFLAFRK
ILLHYNALCILYFRVERESSGNGSGVFENVKEIFGQTIIHHHIPFNWDCEFIRLHFGHNR
KKHLNYTEFTQFLQELQLEHARQAFALKDKSKSGMISGLDFSDIMVTIRSHMLTPFVEEN
LVSAAGGSISHQVSFSYFNAFNSLLNNMELVRKIYSTLAGTRKDVEVTKEEFAQSAIRYG
QVTPLEIDILYQLADLYNASGRLTLADIERIAPLAEGALPYNLAELQRQQSANVAGQKWL
MIGTQGFSFLIGYFVVGGKSFQSIGDNRSKKEINKGLGTTLVDFLLKNSYDLIHSYVLKF
KSVSGKYLPYVPRPIVTNLQSIQQLSLQCNRFKERETQANQHVKLGQYIVGGPAGGSQVI
FTNPLEIVKIRLQVAGEITTGPRVSALNVLRDLGIFGLYKGAKACFLRDIPFSAIYFPVY
AHCKLLLADENGHVGGLNLLAAGAMAVSCAPETLSTAKLSIKTKVSSTPQQTTLNSIFVF
FRANMHPFLPLSFRSVGAAKDTWFSPPFPNQLLPNSRVRLFFYMALSQNKPAGSEPTPKS
RIADLPPANPDHIGGYRLATATFAGIENKFGLYLPKFKSPSVAVVQPKAAVAATQ
Download sequence
Identical sequences ENSGGOP00000024026 ENSGGOP00000024026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]