SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024041 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024041
Domain Number 1 Region: 27-110,139-204
Classification Level Classification E-value
Superfamily EF-hand 2.3e-26
Family Calmodulin-like 0.0028
Further Details:      
 
Domain Number 2 Region: 432-513,551-561
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 6.05e-19
Family Ferredoxin reductase FAD-binding domain-like 0.012
Further Details:      
 
Domain Number 3 Region: 567-752
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 0.000000000000895
Family Flavohemoglobin, C-terminal domain 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024041   Gene: ENSGGOG00000010059   Transcript: ENSGGOT00000028547
Sequence length 752
Comment pep:known_by_projection chromosome:gorGor3.1:15:48375778:48418179:1 gene:ENSGGOG00000010059 transcript:ENSGGOT00000028547 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNTSGDPAQTGPEGCRGTMSAEEDARWLRWVTQQFKTIAGEDGEISLQEFKAALHVKESF
FAERFFALFDSDRSGTITLQELQEALTLLIHGSPMDKLKFLFQVYDIDVCAWQGASAGTE
WGAGAGPHWASSPLGTGSGSIDPDELRTVLQSCLRESAISLPDEKLDQLTLALFESADAD
GNGAITFEELRDELQRFPGVMENLTISAAHWLQLTRAYWHNHRSQLFCLATYAGLHVLLF
ALAASAHQDLGASVMVAKGCGQCLNFDCSFIAVLMLRRCLTWLRATWLAQVLPLDQNIQF
HQLMGYVVVGLSLVHTVAHTVNFVLQAQAEASPFQFWELLLTTRPGIGWVHGSASPTGVA
LLLLLLLMFICSSSCIRRSGHFEVFYWTHLSYLLVWLLLIFHGPNFWKWLLVPGILFFLE
KAIGLAVSRMAAVCIMEVNLLPSKVTHLLIKRPPFFHYRPGDYLYLNIPTIARYEWHPFT
ISSAPEQKDTIWLHIRSQGQWTNRLYESFKASDPLGRGSKRLSRSVTMRKSQRSSKGSEI
LLEKHKFCNIKCYIDGPYGTPTRRIFASEHAVLIGAGIGITPFASILQSIMYRHQKRKHT
CPSCQHSWIEGVQDNMKLHKVDFIWINRDQRSFEWFVSLLTKLEMDQAEEAQYGRFLELH
MYMTSALGKNDMKAIGLQMALDLLANKEKKDSITGLQTRTQPGRPDWSKVFQKVAAEKKG
KVQVFFCGSPALAKVLKGHCEKFGFRFFQENF
Download sequence
Identical sequences ENSGGOP00000024041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]