SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024067 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024067
Domain Number 1 Region: 840-1130
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000101
Family Rhodopsin-like 0.04
Further Details:      
 
Domain Number 2 Region: 460-519
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.0000602
Family Hormone receptor domain 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000024067
Domain Number - Region: 188-304,337-389
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.00596
Family YVTN repeat 0.095
Further Details:      
 
Domain Number - Region: 557-654
Classification Level Classification E-value
Superfamily STAT 0.0392
Family STAT 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024067   Gene: ENSGGOG00000016317   Transcript: ENSGGOT00000023482
Sequence length 1416
Comment pep:known_by_projection chromosome:gorGor3.1:1:84085774:84277889:1 gene:ENSGGOG00000016317 transcript:ENSGGOT00000023482 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSLWFIIVISFLPNTEGFSRAALPFGLVRRELSCEGYSIDLRCPGSDVIMIESANYGRT
DDKICDADPFQMENTDCYLPDAFKIMTQRCNNRTQCIVVTGSEVFPDPCPGTYKYLEVQY
ECVPYMEEKVFVCPGTLKAIVDSPCIYEAEQKAGAWCKDPLQAADKIYFMPWTPYRTDTL
IEYASLEDFQNSRQTTTYKLPNRVDGTGFVVYDGAVFFNKERTRNIVKFDLRTRIKSGEA
IINYANYHDTSPYRWGGKTDIDLAVDENGLWVIYATEQNNGMIVISQLNPYTLRFEATWE
TVYDKRAASNAFMICGVLYVVRSVYQDNESETGKNSIDYIYNTRLNRGEYVDVPFPNQYQ
YIAAVDYNPRDNQLYVWNNNFILRYSLEFGPPDPAQVPTTAVTITSSAELFKTTISTTST
TSQKGPMSTTVAGSQEGSKGTKPPPAVSTTKIPPVTNIFPLPERFCDALDSKGIKWPQTQ
RGMMVERPCPKGTRGTASYLCMISTGTWNPKGPDLSNCTSHWVNQLAQKIRSGENAASLA
NELAKHTKGPVFAGDVSSSVRLMEQLVDILDAQLQELKPSEKDSAGRSYNKKLQKREKTC
RAYLKAIVDTVDNLLRPEALESWKHMNSSEQAHTATMLLDTLEEGAFVLADNLLEPTRVS
MPTENIVLEVAVLSTEGQIQDFKFPLGIKGAGSSIQLSANTVKQNSRNGLAKLVFIIYRS
LGQFLSTENATIKLGADFIGRNSTIAVNSHVISVSINKESSRVYLTDPVLFTLPHIDPDN
YFNANCSFWNYSERTMMGYWSTQGCKLVDTNKTRTTCACSHLTNFAILMAHREIAYKDGV
HELLLTVITWVGIVISLVCLAICIFTFCFFRGLQSDRNTIHKNLCINLFIAEFIFLIGID
KTKYVIACPIFAGLLHFFFLAAFAWMCLEGVQLYLMLVEVFESEYSRKKYYYVAGYLFPA
TVVGVSAAIDYKSYGTEKACWLHVDNYFIWSFIGPVTFIILLNIIFLVITLCKMVKHSNT
LKPDSSRLENINNYRVCDGYYNTDLPGSWVLGAFALLCLLGLTWSFGLLFINEETIVMAY
LFTIFNAFQGVFIFIFHCALQKKVRKEYGKCFRHSYCCGGLPTESPHSSVKASTTRTSAR
YSSGTQSRIRRMWNDTVRKQSESSFISGDINSTSTLNQGMTGNYLLTNPLLRPHGTNNPY
NTLLAETVVCNAPSAPVFNSPGHSLNNARDTSAMDTLPLNGNFNNSYSLRKGDYNDSMQV
VDCGLSLNDTAFEKMIISELVHNNLRGSSKTHNLELTLPVKPVIGGSSSEDDAIVADASS
LMHSDNPGLELHHKELEAPLIPQRTHSLLYQPQKKVKSEGTDSYVSQLTAEAEDHLQSPN
RDSLYTSMPNLRDSPYPESSPDMEEDLSPSRRSENE
Download sequence
Identical sequences ENSGGOP00000024067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]