SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024091 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024091
Domain Number 1 Region: 10-43,99-174
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000000909
Family Calmodulin-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024091   Gene: ENSGGOG00000005442   Transcript: ENSGGOT00000025548
Sequence length 490
Comment pep:known_by_projection chromosome:gorGor3.1:5:21368679:21417751:-1 gene:ENSGGOG00000005442 transcript:ENSGGOT00000025548 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKELMPHLTFNGNGKINVNSIMEGLKKFKPKGMVTLHKLKTANDIKDRVTGHMAVSEIKP
KLKLNPLTKVPISHNKRDRDLPGSLQCQLQHKEKKLSASQMAAFQDAYNFFYKDKTGCID
FHGLMCTVAKLGMNLTKHDVYNELKCADIDRDGKVNFSDFIKVLTDKNLFLKAVVPEKET
CLDLAGNPGILLFEILSRLLETSALPRKSIIEIVSYFQRKFQHTGPGMLWSPYTMGYGKR
TLKPDICTPPSSSMAAFANAARIAIMKEKDLFKFLEELKRCNSGSDSPYSKIPIFPLFPN
VDGVVMGKPFKDMQKLEMLRRKEPLHFFEDYFFHKRDWKTQAANIKSMDPASGYSNNILT
IDQMLKKKQTCTVASATAIKQHVKRATDTYNLGIALEHRKEMLNLWQKIRGDLIGIDSRN
ESFYDTFSTYTWSWNVCQELLSPKDLRLYDAYVNRNSSHNCRSSSSSDTSECDTDSGRKR
KQKGLKGFQQ
Download sequence
Identical sequences ENSGGOP00000005326 ENSGGOP00000024091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]