SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024094 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024094
Domain Number 1 Region: 170-576
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 9.08e-88
Family L-arabinose binding protein-like 0.00051
Further Details:      
 
Domain Number 2 Region: 102-158
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000208
Family Complement control module/SCR domain 0.0000354
Further Details:      
 
Domain Number 3 Region: 55-102
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000375
Family Complement control module/SCR domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024094   Gene: ENSGGOG00000004472   Transcript: ENSGGOT00000023959
Sequence length 961
Comment pep:known_by_projection chromosome:gorGor3.1:6:30517824:30547267:-1 gene:ENSGGOG00000004472 transcript:ENSGGOT00000023959 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLLLLAPLFLRPPGAGGAQTPNATSEGCQIIHPPWEGGIRYRGLTRDQVKAINFLPVD
YEIEYVCRGEREVVGPKVRKCLANGSWTDMDTPSRCVRICSKSYLTLENGKVFLTGGDLP
ALDGARVDFRCDPDFHLVGSSRSICSQGQWSTPKPHCQVNRTPHSERRAVYIGALFPMSG
GWPGGQACQPAVEMALEDVNSRRDILPDYELKLIHHDSKCDPGQATKYLYELLYNDPIKI
ILMPGCSSVSTLVAEAARMWNLIVLSYGSSSPALSNRQRFPTFFRTHPSATLHNPTRVKL
FEKWGWKKIATIQQTTEVFTSTLDDLEERVKEAGIEITFRQSFFSDPAVPVKNLKRQDAR
IIVGLFYETEARKVFCEVYKERLFGKKYVWFLIGWYADNWFKIYDPSINCTVDEMTEAVE
GHITTEIVMLNPANTRSISNMTSQEFVEKLTKRLKRHPEETGGFQEAPLAYDAIWALALA
LNKTSGGGGRSGVRLEDFNYNNQTITDQIYRAMNSSSFEGVSGHVVFDASGSRMAWTLIE
QLQGGSYKKIGYYDSTKDDLSWSKTDKWIGGSPPADQTLVIKTFRFLSQKLFISVSVLSS
LGIVLAVVCLSFNIYNSHVRYIQNSQPNLNNLTAVGCSLALAAVFPLGLDGYHIGRNQFP
FVCQARLWLLGLGFSLGYGSMFTKIWWVHTVFTKKEEKKEWRKTLEPWKLYATVGLLVGM
DVLTLAIWQIVDPLHRTIETFAKEEPKEDIDVSILPQLEHCSSRKMNTWLGIFYGYKGLL
LLLGIFLAYETKSVSTEKINDHRAVGMAIYNVAVLCLITAPVTMILSSQQDAAFAFASLA
IVFSSYITLVVLFVPKMRRLITRGEWQSEAQDTMKTGSSTNNNEEEKSRLLEKENRELEK
IIAEKEERVSELRHQLQSRQQLRSRRHPPTPPEPSGGLPRGPPEPPDRLSCDGSRVHLLY
K
Download sequence
Identical sequences A0A1U9X7R0 A0A2I3TTF4 G3S7N5 Q9UBS5
ENSP00000366233 ENSP00000373034 ENSP00000373134 ENSP00000388035 ENSP00000406066 ENSP00000411286 ENSP00000448999 gi|10835015|ref|NP_001461.1| NP_001461.1.87134 NP_001461.1.92137 XP_003829769.1.60992 XP_016810609.1.37143 XP_018885031.1.27298 ENSP00000366176 ENSP00000373033 ENSP00000373133 ENSP00000394528 ENSP00000406066 ENSP00000406285 ENSP00000366233 ENSP00000373034 ENSP00000373134 ENSP00000388035 ENSP00000406066 ENSP00000411286 ENSP00000448999 9606.ENSP00000366233 9606.ENSP00000373034 9606.ENSP00000373134 9606.ENSP00000388035 9606.ENSP00000406066 9606.ENSP00000411286 ENSGGOP00000024094 ENSGGOP00000004389

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]