SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024095 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024095
Domain Number 1 Region: 23-200
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 4.35e-58
Family MHC antigen-recognition domain 0.00000000707
Further Details:      
 
Domain Number 2 Region: 207-294
Classification Level Classification E-value
Superfamily Immunoglobulin 2.54e-21
Family C1 set domains (antibody constant domain-like) 0.00000466
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024095   Gene: ENSGGOG00000014730   Transcript: ENSGGOT00000024213
Sequence length 327
Comment pep:known_by_projection chromosome:gorGor3.1:1:137254052:137258136:1 gene:ENSGGOG00000014730 transcript:ENSGGOT00000024213 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLFLLLPLLAVLPGDGNADGLKEPLSFRVIWIESFYNHSWKQNLVSGWLSDLQTHTWDSN
SSTIVFLWPWSRGNFSNEEWKELETLFRIRIIRSFEGIRRYAHELQFEYPFEIQVTGGCE
LHSGKVSGSFLQLAYQGSDFVSFQNSSWLPYPVAGNMAKHFCKVLNQNQHENDITHNLLS
DTCPRFILGLLDAGKAHLQRQVKPEAWLSHGPSPGPGHLQLVCHVSGFYPKPVWVMWMRG
EQEQQGTQRGDILPSADGTWYLRATLEVAAGEAADLSCRVRHSSLEGQDIVLYWEHHSSV
GFIILAVIVPLLLLIGLALWFRKRCFC
Download sequence
Identical sequences G3S7N6
ENSGGOP00000024095 XP_004027071.1.27298 ENSGGOP00000024095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]