SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024127 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024127
Domain Number 1 Region: 87-187
Classification Level Classification E-value
Superfamily EF-hand 1.35e-29
Family Eps15 homology domain (EH domain) 0.00000244
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000024127
Domain Number - Region: 418-474
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0549
Family Myosin rod fragments 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024127   Gene: ENSGGOG00000016013   Transcript: ENSGGOT00000025041
Sequence length 479
Comment pep:known_by_projection chromosome:gorGor3.1:X:17011659:17140175:1 gene:ENSGGOG00000016013 transcript:ENSGGOT00000025041 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KQETQSPTMSPLASPPSSPPHYQRVPLSHGYSKLRSSAEQMHPAPYEARQPLVQPEGSSS
GGPGTKPLRHQASLIRSFSVERELQDNSSYPDEPWRITEEQREYYVNQFRSLQPDPSSFI
SGSVAKNFFTKSKLSIPELSYIWELSDADCDGALTLPEFCAAFHLIVARKNGYPLPEGLP
PTLQPEYLQAAFPKPKWDCQLFDSYSESLPANQQPRDLNRMEKTSVKDMADLPVPTQDVT
SDDKQALKSTINEALPKDVSEDPATPKDSNSLKARPRSRSYSSTSIEEAMKRGEDPPTPP
PRPQKTHSRASSLDLNKVFQPSVPATKSGLLPPPPALPPRPCPSQSEQVSEAELLPQLSR
APSQAAESSPAKKDVLYSQPPSKPIRRKFRPENQAAENQEPSTAASGPASAATMKPHPTV
QKQSSKQKKAIQTAIRKNKEANAVLARLNSELQQQLKEVHQERIALENQLEQLRPVTVL
Download sequence
Identical sequences ENSGGOP00000024127

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]