SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024143 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024143
Domain Number 1 Region: 115-381
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 9.13e-57
Family Eukaryotic proteases 0.00012
Further Details:      
 
Domain Number 2 Region: 71-130
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000916
Family Complement control module/SCR domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024143   Gene: ENSGGOG00000013039   Transcript: ENSGGOT00000033291
Sequence length 382
Comment pep:known_by_projection chromosome:gorGor3.1:16:62323509:62360957:1 gene:ENSGGOG00000013039 transcript:ENSGGOT00000033291 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VYACVCVCVYMHVCVDACMCCEAGRPAFHSFLFSLCSDLGAVISLLLWGRQLFALYSGND
VTDISDDRFPKPPEIANGYVEHLFRYQCKNYYRLRTEGDGVYTLNDKKQWINKAVGDKLP
ECEAVCGKPNPANPVQRILGGHLDAKGSFPWQAKMVSRHNLTTGASLINEQWLLTTAKNL
FLSHSENAIAKDIAPTLTLYVGEKQLVEIEKVVLHPNYHQVDIGLIKLKQKVPVNERVMP
ICLPSKDYAEAGRVGYASGWGQSDNFKLTDHLKYVMLPVADQYDCIKHYEGSTCPKWKAP
KSPVGVQPILNEHTFCAGMSKYQEDTCYGDAGSAFAVHDLEEDTWYAAGILSFDKSCAVA
EYGVYVKVTSIQDWVQKTIAEN
Download sequence
Identical sequences ENSGGOP00000024143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]