SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024144 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024144
Domain Number 1 Region: 655-732
Classification Level Classification E-value
Superfamily BRCT domain 3.66e-16
Family BRCT domain 0.0097
Further Details:      
 
Domain Number 2 Region: 5-93
Classification Level Classification E-value
Superfamily BRCT domain 0.00000000000000249
Family DNA ligase 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024144   Gene: ENSGGOG00000010024   Transcript: ENSGGOT00000024276
Sequence length 740
Comment pep:known_by_projection chromosome:gorGor3.1:8:6292875:6363965:1 gene:ENSGGOG00000010024 transcript:ENSGGOT00000024276 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPILKDVVAYVEVWSSNGTENYSKTFTTQLVDMGAKVSKTFNKQVTHVIFKDGYQSTW
DKAQKRGVKLVSVLWVEKCRTAGAHIDESLFPAANTNEHLPSLIKKKRKCMQPKDFNFKT
PENDKRFQKKFEKMAKELQRQKTSLDDDVPILLFESNGSLIYTPTIEINSSHHSAMEKRL
QEMKEKRENLSPTSSQLIQQSHDNPSNSLCEAPLNISRDTLCSDEYFAGGLHSSFDDLCG
NSGCGNQERKLEGSINDIKSDVCISSLVSKANNIHSSPSFTHLDKSSPQKFLSNLSKEEI
NLQRNIAGKIVTPDQKQAAGMSQETFEEKYRLSPTLSSIKGHLLIHSRPRSSSVKRKRVS
HGSHSPPKEKCKRKRSIRRSIMPRLQLCRSEGRLQHVAGPALKALSCGESSYDDYFSPDN
LKERNSENLPPESQLPSSPAQFSCRSLSKKERTSIFEMSDFSCVGKKTRTVDITNFTAKT
ISSPQKTGNGEGRATSSCVTSAPEEALRCCRQAGKEDGCPEGNGFSYTIEDPALPKGHDG
DLTALEGSLEEMKEAVGLKSTQNRGTTSKISNSSEGEAQSEHEPCFIVDCNMETSTEEKE
NLPGGYSGSIKYLFTQTDTADSMCDGSRLIINPNQEVGESGRGEPPAKNGVQLIFPQIKQ
NVVIQVVDKLKGFSIAPDVCETTTHVLSGKPLRTLNVLLGIARGCWVLSYDWVLWSLELG
HWISEEPFELSHHFPAAPLC
Download sequence
Identical sequences ENSGGOP00000024144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]