SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024158 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024158
Domain Number 1 Region: 235-496
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.93e-56
Family Nuclear receptor ligand-binding domain 0.0000000164
Further Details:      
 
Domain Number 2 Region: 161-239
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.53e-27
Family Nuclear receptor 0.0000262
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024158   Gene: ENSGGOG00000028179   Transcript: ENSGGOT00000032972
Sequence length 498
Comment pep:known_by_projection chromosome:gorGor3.1:9:81959253:82000422:1 gene:ENSGGOG00000028179 transcript:ENSGGOT00000032972 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPCVQAQYSPSPPGSSYAAQTYSSEYTTEIMNPDYTKLTMDLGSTEITATATTSLPSIST
FVEGYSSNYELKPSCVYQMQRPLIKVEEGRAPSPLGAAAAAGSQAAALEGHPYGLPLAKR
AAPLAFPPLGLTPSPTASSLLGESHSLPSPPNRSSSSGEGTCAVCGDNAACQHYGVRTCE
GCKGFFKRTVQKNAKYVCLANKNCPVDKRRRNRCQYCRFQKCLSVGMVKEASVVRTDSLK
GRRGRLPSKPKSPLQQEPSQPSPPSPPICMMNALVRALTDSTPRDLDYSRYCPTDQAAAG
TDAEHVQQFYNLLTASIDVSRSWAEKIPGFTDLPKEDQTLLIESAFLELFVLRLSIRSNT
AEDKFVFCNGLVLHRLQCLRGFGEWLDSIKDFSLNLQSLNLDIQALACLSALSMITERHG
LKEPKRVEELCNKITSSLKDHQSKGQALEPTESKVLGALVELRKICTLGLQRIFYLKLED
LVSPPSIIDKLFLDTLPF
Download sequence
Identical sequences ENSGGOP00000024158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]