SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024166 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024166
Domain Number 1 Region: 189-428
Classification Level Classification E-value
Superfamily SMAD/FHA domain 2.61e-74
Family Interferon regulatory factor 3 (IRF3), transactivation domain 0.000000000692
Further Details:      
 
Domain Number 2 Region: 4-111
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.17e-36
Family Interferon regulatory factor 0.000000961
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024166   Gene: ENSGGOG00000000499   Transcript: ENSGGOT00000034304
Sequence length 428
Comment pep:known_by_projection chromosome:gorGor3.1:19:46990523:46996617:-1 gene:ENSGGOG00000000499 transcript:ENSGGOT00000034304 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTPKPRILPWLVSQLDLGQLEGVAWVNKSRTRFRIPWKHGLRQDAQQEDFGIFQAWAEA
TGAYVPGRDKPDLPTWKRNFRSALNRKEGLRLAEDRSKDPHDPHKIYEFVNSGVGHFSQP
DTSLDTNGFSFFVSLQEDILDELLGNMVLAPLPDPGPPSLAVAPEPCPQPLRSPSLDSPT
PFPNLGPSENPLKRLLVPGEEWEFEVTAFYRGRQVFQQTISCLEGLRLVGSEVGDRTLPG
WPVTLPDPGMSLTDRGVMSYVRHVLSCLGGGLALWRAGQWLWAQRLGHCHTYWAVSEELL
PNSGHGPDGEVNRPIAGKLHPLGAPGPPDLITFTEGSGRSPRYALWFCVGESWPQDQPWT
KRLVMVKVVPTCLRALVEMARVGGASSLENTVDLHISNSHPLSLTSDQYKAYLQDLVDGM
DFQGPGET
Download sequence
Identical sequences ENSGGOP00000024166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]