SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024192 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024192
Domain Number 1 Region: 261-331
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 2.36e-19
Family HLH, helix-loop-helix DNA-binding domain 0.0000519
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024192   Gene: ENSGGOG00000012065   Transcript: ENSGGOT00000030250
Sequence length 1075
Comment pep:known_by_projection chromosome:gorGor3.1:22:26233445:26276676:1 gene:ENSGGOG00000012065 transcript:ENSGGOT00000030250 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EMLQFVSNQVGEFPDLFSEQLCSSFPGSGGSGAVDPSMPRSFTQVTLPSFSPSAASPQAP
TLQVKVSPTSVPTTPRATPIQQTVMITPTFSTAPQTRIIQQPLIYQNAATSFQVLQPQVQ
SLVTSSQVQPVTIQQQVQTVQAQRVLTQTANGTLQTLAPATVQTVAAPQVQQVPVLVQPQ
IIKTDSLVLTTLKTDGSPVMAAVQNPALTALTTPIQTAALQVPTLVGSSGTILTTMPVMM
GQEKVPIKQVPGGVKQLEPPKEGERRTTHNIIEKRYRSSINDKIIELKDLVMGTDAKMHK
SGVLRKAIDYIKYLQQVNHKLRQENMVLKLANQKNKLLKGIDLGSLVDNEVDLKIEDFNQ
NVLLMSPPASDSGSQAGFSPYSIDSEPGSPLLDDAKVKDEPDSPPVALGMVDRSRILLCV
LTFLCLSFNPLTSLLQWGGAHDSDQRPHSGSGRSVLSFESGSGGWFDWMMPTLLLWLVNG
VIVLSVFVKLLVHGEPVIRPHSRSSVTFWRHRKQADLDLARGDFAAAAANLQTCLAVLGR
ALPTSRLDLACSLSWNVIRYSLQKLRLVRWLLKKVFQCRRATPATEAGFEDEAKTSARDA
ALAYHRLHQLHITGKLPAGSACSDVHMALCAVNLAECAEEKIPPSTLVEIHLTAAMGLKT
RCGGKLGFLASYFLSRAQSLCGPEHSAVPDSLRWLCHPLGQKFFMERSWSVKSAAKESLY
CAQRNPADPIAQVHQAFCKNLLERAIESLVKPQAKKKAGDQEEESCEFSSALEYLKLLHS
FVDSVGVMSPPLSSSCVLKSALGPDIICRWWTSAITVAISWLQGDDAAVRSHFTKVERIP
KALEVTESPLVKAIFHACRAMHASLPGKADGQQSSFCHCERASGHLWSSLNVSGATSDPA
LNHVVQLLTCDLLLSLRTALWQKQASASQAVGETYHASGAELAGFQRDLGSLRRLAHSFR
PAYRKVFLHEATVRLMAGASPTRTHQLLEHSLRRRTTQSTKHGEVDAWPGQRERATAILL
ACRHLPLSFLSSPGQRAVLLAEAARTLEKVGDRRSCNDCQQMIVKLGGGTAIAAS
Download sequence
Identical sequences ENSGGOP00000024192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]