SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024222 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024222
Domain Number 1 Region: 644-695
Classification Level Classification E-value
Superfamily EF-hand 0.00000223
Family Calmodulin-like 0.048
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000024222
Domain Number - Region: 547-711
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0209
Family HBL-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024222   Gene: ENSGGOG00000002923   Transcript: ENSGGOT00000028359
Sequence length 753
Comment pep:known_by_projection chromosome:gorGor3.1:4:1795265:1852979:-1 gene:ENSGGOG00000002923 transcript:ENSGGOT00000028359 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASILLRSCRGRAPARLPPPPRYTVPRGSPGDPAHLSCASTLGLRNCLNVPFGCCTPIQP
VSSSSRGDHLGCWTLRPQCLRIVSRAPWTSTSVGFVAVGPQCLPVRGWHSSRPVRDDSVV
EKSLKSLKDKNKKLEEGGPVYSPPAEVVVKKSLGQRVLDELKHYYHGFRLLWIDTKIAAR
MLWRILNGHSLTRRECRQFLRICADLFRLVPFLVFVVVPFMEFLLPVAVKLFPNMLPSTF
ETQSLKEERLKKELRVKLELAKFLQDTIEEMALKNKAAKGSATKDFSVFFQKIRETGERP
SNEEIMRFSKLFEDELTLDNLTRPQLVALCKLLELQSIGTNNFLRFQLTMRLRSIKADDK
LIAEEGVDSLNVKELQAACRARGMRALGVTEDRLRGQLKQWLDLHLHQEIPTSLLILSRA
MYLPDTLSPADQLKSTLQTLPEIVAKEAQVKVAEVEGEQVDNKAKLEATLQEEAAIQQEH
REKELQKRSEAAKDVEPERVVAAPQRPGTEPQPEMPDTVLQSETLKDTAPVLEGLKEEEI
TKEEIDILSNACSKLQEQKKSLTKEKEELEPLKEDVQDYSEDLQEIKKELSKTGEEKYVE
ESKASKRLTKRVQQMIGQIDGLISQLEMDQQAGKLAPANGMPTGENVISVAELINAMKQV
KHIPESKLTSLAAALDENKDGKVNIDDLVKVMELVDKEDVHISTSQVAEIVATLEKEEKV
EEKEGREGGRRGEARTTGLGTCPPAVPPPWQGP
Download sequence
Identical sequences ENSGGOP00000024222 ENSGGOP00000002875

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]