SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024233 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024233
Domain Number 1 Region: 10-105
Classification Level Classification E-value
Superfamily Cystatin/monellin 6.8e-30
Family Cystatins 0.00000275
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024233   Gene: ENSGGOG00000024959   Transcript: ENSGGOT00000022328
Sequence length 107
Comment pep:known_by_projection chromosome:gorGor3.1:3:121947945:121969364:1 gene:ENSGGOG00000024959 transcript:ENSGGOT00000022328 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CPAKKQSAKMIPGGLSEAKPATPEIQEIVDKIKPQLEEKTNETYGKLEAVQYKTQVVAGT
NYYIKVRAGDNKYMHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF
Download sequence
Identical sequences ENSGGOP00000024233 ENSGGOP00000024233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]