SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024266 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024266
Domain Number 1 Region: 32-118
Classification Level Classification E-value
Superfamily Cystatin/monellin 0.00000000000425
Family Cystatins 0.084
Further Details:      
 
Domain Number 2 Region: 160-231
Classification Level Classification E-value
Superfamily Cystatin/monellin 0.0000952
Family Cystatins 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024266   Gene: ENSGGOG00000024591   Transcript: ENSGGOT00000031543
Sequence length 475
Comment pep:known_by_projection chromosome:gorGor3.1:3:188118142:188130022:1 gene:ENSGGOG00000024591 transcript:ENSGGOT00000031543 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VADHSKGWFNKMKALIAALLLITLEYSCAVSPTDCSAVEPEAEKTLDLINKRRRDGYLFQ
LLLIADAHLDRVENTTVYYLVLDVQESDCSVLSRKYWNDCEPPDSRRPSEIVIGQCKVIA
TRHSHESQDLRVIDFNCTTSSVSSALANTKDSPVLIDFFEDTERYRKQADKALEKYKEEN
DDFASFRVDRIERVAKVRGGEGTGYFVDFSVRNCSRHHFPRHPNVFGFCRADLFYDVEAL
DLESPKNLVINCEVFDPQEHENIDGAPPHLGHPFHWGGHERSSATKPPFKPHGSRDHHHP
HKPHEHGPPPPPEERYHSHGPPLPQGPPPLLPMSCSSCQHATFGTNGAQRHSHNNNSSDD
FQDYGPCDPPPHNQGHCCHGHGPPPGHLRKRGPGKGPRPFHCRQIGSVYRLPPLRKGEVL
PLPEANFPSFPLPHHKHPLKPDIQPFPQSVSESCPGKFKSGFPQVSTFFTHTFPK
Download sequence
Identical sequences ENSGGOP00000024266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]