SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024323 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024323
Domain Number 1 Region: 10-297
Classification Level Classification E-value
Superfamily WD40 repeat-like 8.43e-45
Family WD40-repeat 0.0032
Further Details:      
 
Domain Number 2 Region: 1006-1065
Classification Level Classification E-value
Superfamily HMG-box 0.000000121
Family HMG-box 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024323   Gene: ENSGGOG00000007744   Transcript: ENSGGOT00000022887
Sequence length 1123
Comment pep:known_by_projection chromosome:gorGor3.1:14:35759554:35846057:-1 gene:ENSGGOG00000007744 transcript:ENSGGOT00000022887 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPATRKPMRYGHTEGHTEVCFDDSGSFIVTCGSDGDVRIWEDLDDDDPKFINVGEKAYSC
ALKNGKLVTAVSNNTIQVHTFPEGVPDGILTRFTTNANHVVFNGDGTKIAAGSSDFLVKI
VDVMDSSQQKTFRGHDAPVLSLSFDPKDIFLASASCDGSVRVWQISDQTCAISWPLLQKC
NDVINAKSICRLAWQPKSGKLLAIPVEKSVKLYRRESWSHQFDLSDNFISQTLNIVTWSP
CGQYLAAGSINGLIIVWNVETKDCMERVKHEKGYAICGLAWHPTCGRISYTDAEGNLGLL
ENVCDPSGKTSSSKVSSRVEKDYNDLFDGDDMSNAGDFLNDNAVEIPSFSKGIINDDEDD
EDLMMASGRPRQRSHILEDDENSVDISMLKTGSSLLKEEEEDGQEGSIHNLPVVTSQRPF
YDGPMPTPRQKPFQSGSTPLHLTHRFMVWNSIGVIRCYNDEQDNAIDVEFHDTSIHHATH
LSNTLNYTIADLSHEAILLACESTDELASKLHCLHFSSWDSSKEWIIDLPQNEDIEAICL
GQGWAAAATSALLLRLFTIGGVQKEVFSLAGPVVSMAGHGEQLFIVYHRGTGFDGDQCLG
VQLLELGKKKKQILHGDPLPLTRKSYLAWIGFSAEGTPCYVDSEGIVQMLNRGLGNTWTP
ICNTREHCKGKSDHYWVVGIHENPQQLRCIPCKGSRFPPTLPRPAVAILSFKLPYCQIAT
EKGQMEEQFWRSVIFHNHLDYLAKNGYEYEESTKNQATKEQQELLMKMLALSCKLEREFR
CVELADLMTQNAVNLAIKYASRSRKLILAQKLSELAVEKAAELTATQDFRKKLNAGYSNT
ATEWSQPRFRNQVEEDAKDSGEADDEEKPEIHKPGQNLFSTSTNSSDVSAKSVKGAVTFS
SQGRVNPFKVSASSKEPAMSMNSARSTNILDNMGKSSKKSTALSRTTNNEKSPIIKPLIP
KPKPKQASAASYFQKRNSQTNKTEKVKEENLKNVLSETPAICPPQNTENQRPKTGFQLWL
EENRSNILSDNPDFSDEADIIKEGMIRFRVLSTEERKVWANKAKGETASEGTEAKKRKRV
VDESDETENQEEKAKENLNLSKKQKPLDFSTNQKLSAFAFKQE
Download sequence
Identical sequences ENSGGOP00000024323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]