SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024334 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024334
Domain Number 1 Region: 129-191
Classification Level Classification E-value
Superfamily HSP20-like chaperones 0.00000105
Family HSP20 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024334   Gene: ENSGGOG00000023400   Transcript: ENSGGOT00000024451
Sequence length 253
Comment pep:known_by_projection chromosome:gorGor3.1:8:101786070:101796373:1 gene:ENSGGOG00000023400 transcript:ENSGGOT00000024451 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALSCLLDSVRRDIKKVDRELRQLRCIDEFSTRCLCDLYMHPYCCCDLHPYPYCLCYSK
RSRSCGLCDLYPCCLCDYKLYCLRPSLRSLERKAIRAIEDEKRELAKLRRTTNRILASSC
CSSNILGSVNVCGFEPDQVKVRVKDGKVCVSAERENRYDCLGSKKYSYMNICKEFSLPPC
VDEKDVTYSYGLGSCVKIESPCYPCTSPCNPCNPCNPCSPCNPCNPCSPCNPCDPCNPCY
PCGSRLSCRKMIL
Download sequence
Identical sequences G3S8C1
ENSGGOP00000024334 XP_004047444.1.27298 ENSGGOP00000024334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]