SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024360 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024360
Domain Number 1 Region: 463-588
Classification Level Classification E-value
Superfamily EF-hand 3.53e-16
Family Calmodulin-like 0.0095
Further Details:      
 
Domain Number 2 Region: 588-753
Classification Level Classification E-value
Superfamily EF-hand 9.62e-16
Family Calmodulin-like 0.0078
Further Details:      
 
Domain Number 3 Region: 164-282
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000935
Family Calmodulin-like 0.019
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000024360
Domain Number - Region: 771-820
Classification Level Classification E-value
Superfamily EF-hand 0.000546
Family Calmodulin-like 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024360   Gene: ENSGGOG00000022715   Transcript: ENSGGOT00000022404
Sequence length 899
Comment pep:known_by_projection chromosome:gorGor3.1:5:36677737:36788410:-1 gene:ENSGGOG00000022715 transcript:ENSGGOT00000022404 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METKVHLFCQAEENIDLLDDGSNSFATDLSSGTINHKKYIKFSKTIEKKMSPEIRSLSPE
YKKIFETSIILCGEEKSSDFSGEKVGRKSLQVQQHSKRTEIIPPFLKLSKEKVTRKENSL
CKLPNQYSVHKTSSPLCTSSAITREKEMLSNLYMTLYDEVTHGYLHSKELSALHKACKIF
SKIRSGKIYVNDLPVILCILRISISDLEMRQALKTVDTDAFQDALKIFCRIKGGRVSTDD
VFAVLDSMGIPINREILEEVTKHTYIDSNHMVDIGDIIFTLNELQEQYEDVSITEGSPLN
EITSDRKLSSIAGCYLKYKKKNSLSSKLPEPSISKKLNKKSNQYYSKIMENDDLESKRPK
NTWQIRKFLGGVGSSNVGVQEPYSKNGINFKKHSEKGEIHDSKSKPQSLKSSTRLSKSLD
KSDISSIPKLQKPAVRRHSSLQKQVSSTEKTAISTLENFREAISKLQENYIAAEELQSIL
PSTGINLLDEEFQKIVTDTSRNENGMVELDDFISALAKERSFPECNALPGVVKAIDKIKD
KNVDYEDLNTCLQNFGIYLSKPEFKKITELTEAGEGDEVQFEEFPKVVRNMRDAARLEEL
QEVVLAADLLEGDMIAGKNLEDFLRNIGIKSPKEEVEKILQSGFVSEDNMVNIKDCMRAL
RDTQKFSSYIDFRKEASNLKLPKVNEIKEAANILSHVDNGKIGIPDLEHALKCLNVNLTE
EDFGEPLNCCNVSDNMEVDLKDFLMKMKESPHFQKSKATQILLATTQILQNDLVDVSDLK
TLLMDKDLHTANAILTVMLRHVPEHESGKVSIQEFMTKLSDILTIPKAAGKFYLICTYCP
DLERQAVVYMLKTIQDSIVKAQVSKKQHNMNIKQHKIRLHNFCLNSKANIAKLNPNSKF
Download sequence
Identical sequences ENSGGOP00000024360 ENSGGOP00000024360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]