SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024368 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024368
Domain Number 1 Region: 3-151
Classification Level Classification E-value
Superfamily L domain-like 1.87e-24
Family U2A'-like 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024368   Gene: ENSGGOG00000026058   Transcript: ENSGGOT00000032875
Sequence length 197
Comment pep:novel chromosome:gorGor3.1:15:54935760:54936523:-1 gene:ENSGGOG00000026058 transcript:ENSGGOT00000032875 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDMKRRIHLELRNWTPSAVRELVLDNCKSNDGKIEGLTAEFVNLEFLSLINVGLISVSNL
PKLPKLKKLELSENRIFGGLDVLAEKLPNLTRLNLSGNKPKDTSTLEPLKKLECLKSLDL
FNCEVTNMNDYREVFKLLPQLTYVDGYDQEDQEEPDSDAEVDGVVSEEEEEFGLDEEEEE
GRKGKKRKRETDGEGED
Download sequence
Identical sequences ENSGGOP00000024368 ENSGGOP00000024368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]