SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024402 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024402
Domain Number 1 Region: 149-338
Classification Level Classification E-value
Superfamily HAD-like 2.76e-50
Family phosphatase domain of polynucleotide kinase 0.0000000457
Further Details:      
 
Domain Number 2 Region: 4-109
Classification Level Classification E-value
Superfamily SMAD/FHA domain 3.3e-28
Family FHA domain 0.00000135
Further Details:      
 
Domain Number 3 Region: 360-504
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.59e-18
Family Nucleotide and nucleoside kinases 0.00000888
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024402   Gene: ENSGGOG00000010193   Transcript: ENSGGOT00000025265
Sequence length 522
Comment pep:known_by_projection chromosome:gorGor3.1:19:47200810:47207128:-1 gene:ENSGGOG00000010193 transcript:ENSGGOT00000025265 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEVEAPGRLWLESPPGGAPPIFLPSDGQALVLGRGPLTQVTDRKCSRTQVELVADPETR
TVAVKQLGVNPSTTGTQELKPGLEGSLGVGDTLYLVNGLHPLTLRWEETRTRESQPDTPP
GTPPVSQDEKRDAELPKKRMRKSNPGWENLEKLLVFTAAGVKPQGKVAGFDLDGTLITTR
SGKVFPTGPSDWRILYPEIPRKLRELEAEGYKLVIFTNQMSIGRGKLPAKEFKAKVEAVV
EKLGVPFQVLVATHAGLYRKPVTGMWDHLQEQANDGEPISIGDSIFVEDAAGRPANWAPG
RKKKDFSCADRLFALNLGLPFATPEEFFLKWPAAGFELPAFDPRTVSRSGPLCLPESRAL
LSASPEVVVAVGFPGAGKSTFLKKHLVSAGYVHVNRDTLGSWQRCVTTCETALKQGKRVA
IDNTNPDAASRASRRGPAAGWAGPAHPAPSXTATLEQARHNNRFREMTDSSHIPVSDMVM
YGYRKQFEAPTPAEGFSAILEIPFRLWVEPRLGRLYCQFSEG
Download sequence
Identical sequences ENSGGOP00000024402 ENSGGOP00000009949

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]