SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024430 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024430
Domain Number 1 Region: 292-415
Classification Level Classification E-value
Superfamily SH2 domain 2.02e-23
Family SH2 domain 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024430   Gene: ENSGGOG00000009657   Transcript: ENSGGOT00000032135
Sequence length 431
Comment pep:known_by_projection chromosome:gorGor3.1:8:19080130:19158095:1 gene:ENSGGOG00000009657 transcript:ENSGGOT00000032135 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKQILSEMYIDPDLLAELSEEQKQILFFKMREEQIRRWKEREAAMERKESLPVKPRPKK
DCYNGIELNWSLICRLKVLIWISSKSHSDKPMPHTCREILAESEWLRKAKRKQLRVCFKA
QRLRTANVLRTKSCNCCDQCMWKDEQSSTLKLFLFKENSGVSLKQLSTVSEEKKQKKESM
KKKQEEEINQIEEERTKQICKSWKEDSEWQASLRKSKAADEKRRSLAKQAREDYKRLSLG
AQKGRGGERLQSPLRVPQKPKRPPLPPKPQFLNPGAYPQKPLRNQGLVRTVSSSAQEDII
RWFKEEQLPLRAGYQKTSDTIAPWFHGILTLKKANELLLSTGMPGSFLIRVSERIKGYAL
SHLSEDGCKHFLIDASADAYSFLGVDQLQHATLADLVEYHKEEPITSLGKELLLYPCGQQ
DQLPDYLELFE
Download sequence
Identical sequences ENSGGOP00000009431 ENSGGOP00000024430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]