SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024452 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024452
Domain Number 1 Region: 313-429
Classification Level Classification E-value
Superfamily EF-hand 1.46e-31
Family Osteonectin 0.0087
Further Details:      
 
Domain Number 2 Region: 223-294
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 1.83e-20
Family Thyroglobulin type-1 domain 0.0016
Further Details:      
 
Domain Number 3 Region: 89-161
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 4.71e-19
Family Thyroglobulin type-1 domain 0.0014
Further Details:      
 
Domain Number 4 Region: 43-88
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000018
Family Ovomucoid domain III-like 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024452   Gene: ENSGGOG00000008202   Transcript: ENSGGOT00000027707
Sequence length 435
Comment pep:known_by_projection chromosome:gorGor3.1:14:51050599:51209912:1 gene:ENSGGOG00000008202 transcript:ENSGGOT00000027707 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPARCARLLTPHLLLVLVQLSPARGHRTTGPRFLISDRDPQCNLHCSRTQPKPICASDG
RSYESMCEYQRAKCRDPTLGVVHRGRCKDAGQSKCRLERAQALEQAKKPQEAVFVPECGE
DGSFTQVQCHTYTGYCWCVTPDGKPISGSSVQNKTPVCSGSVTDKPLSQGNSGRKDDGSK
PTPTMETQPVFDGDEITAPTLWIKHLVIKDSKLNNTNIRNSDKVYSCDQERQSALEEARQ
NPREGIVIPECAPGGLYKPVQCHQSTGYCWCVLVDTGRPLPGTSTRYVMPSCESDARAKT
TEADDPFKDRELPGCPEGKKMEFITSLLDALTTDMVQAINSAAPTGGGRFSEPDPSHTLE
ERVVHWYFSQLDSNSSNDINKREMKPFKRYVKKKAKPKKCARRFTDYCDLNKDKVISLPE
LKGCLGVSKEVGRLV
Download sequence
Identical sequences G3S8N9
ENSGGOP00000008018 XP_018865656.1.27298 ENSGGOP00000024452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]