SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024477 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024477
Domain Number 1 Region: 482-543
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000128
Family Erythroid transcription factor GATA-1 0.025
Further Details:      
 
Domain Number 2 Region: 380-421
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000122
Family Myb/SANT domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024477   Gene: ENSGGOG00000015245   Transcript: ENSGGOT00000023759
Sequence length 1516
Comment pep:known_by_projection chromosome:gorGor3.1:1:8508975:8810550:-1 gene:ENSGGOG00000015245 transcript:ENSGGOT00000023759 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KRDKARESENSRPRRSCTLEGGAKNYAESDHSEDEDNDNNSATAEESTKKNKKKPPKKKS
RYERTDTGEITSYITEDDVVYRPGDCVYIESRRPNTPYFICSIQDFKLVHNSQACCRSPT
PALCDPPACSLPVASQPPQHLSEAGRGPVGSKRDHLLMNVKWYYRQSEVPDSVYQHLVQD
RHNENDSGRELVITDPVIKNRELFISDYVDTYHAAALRGKCNISHFSDIFAAREFKARVD
SFFYILGYNPETRRLNSTQGEIRVGPSHQAKLPDLQPFPSPDGDTVTQHEELVWMPGVND
CDLLMYLRAARRSMAAFAGMCDGGSTEDGCVAASRDDTTLNALNTIYLPKCSFSFSLAFG
RLGKREIPVTISKCGSEDLKKRFVKGLRQYGKNFFRIRKELLPNKETGELITFYYYWKKT
PEAASSRAHRRHRRQAVFRRIKTRTASTPVNTPSRPPSSEFLDLSSASEDDFDSEDSEQE
LKGYACRHCFTTTSKDWHHGGRENILLCTDCRIHFKKYGELPPIEKPVDPPPFMFKPVKE
EDDGLSGKHSMRTRRSRGSMSTLRSGRKKQPASPDGRTSPINEDIRSSGRNSPSAASTSS
NDSKAETVKKSAKKVKEEASSPLKSNKRQREKVASDTEEADRTSSKKTKTQEISRPNSPS
EGEGESSDSRSVNDEGSSDPKDIDQDNRSTSPSIPSPQDNESDSDSSAQQQMLQAQPPAL
QAPTGVTPAPSSAPPGTPQLPTPGPTPSATAVPPQGSPTASQAPNQPQAPTAPVPHTHIQ
QAPALHPQRPPSPHPSPHPPLQPLTGSAGQPSAPSHAQPPLHGQGPPGPHSLQAGPPLPF
GLPPQASQGQAPLGTSPAAAHPHTSLQLPASQSALQSQQPPREQPLPPAPLAMPHIKPPP
TTPIPQLPAPQAHKHPPHLSGPSPFSMNANLPPPPALKPLSSLSTHHPPSAHPPPLQLMP
QSQPLPSSPAQPPGLTQSQNLPPPPFAQHPFVPGGPPPITPPTCPSTSTPPAGPGTSAQP
PCSGAVASGGSIAGGSSCPLPTVQIKEEALDDTEEPESPPPPPRSPSPEPTVVDTPSHAS
QSARFYKHLDRGYNSCARTDLYFMPLAGSKLAKKREEAIEKAKREAEQKARGQGRAGSPW
RDQVGLSEQARNRTRPTSAKASSSAHEGRLSDPQLSGPGHMRPSFEPPPTTIAAVPPYIG
PDTPALRTLSEYARPHVMSPTNRNHPFYMPLNPTDPLLAYHMPGLYNVDPTIRERELRER
EIREREIRERELRERMKPGFEVKPPELDPLHPAANPMEHFARHSALTIPPTAGPHPFASF
HPGLNPLERERLALAGPQLRPEMSYPDRLAAERIHAERMASLTSDPLARLQMFNVTRSHL
FIHEALHKRTRKCLHQRSAGPVHPLVDPLTAGPHLARFPYPPGTLPNPLLGQPPHEHEML
RHPVFGTPYPRDLPGAIPPPMSAAHQLQAMHAQSAELQRLAMEQQWLHGHPHMHGGHLPS
QEDYYSRLKKEGDKQL
Download sequence
Identical sequences ENSGGOP00000024477 ENSGGOP00000024477

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]