SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024481 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024481
Domain Number 1 Region: 177-521
Classification Level Classification E-value
Superfamily Cysteine proteinases 4.12e-95
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.00000834
Further Details:      
 
Domain Number 2 Region: 24-130
Classification Level Classification E-value
Superfamily RING/U-box 3.65e-17
Family Zf-UBP 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024481   Gene: ENSGGOG00000025937   Transcript: ENSGGOT00000025366
Sequence length 527
Comment pep:novel chromosome:gorGor3.1:X:56351994:56353622:-1 gene:ENSGGOG00000025937 transcript:ENSGGOT00000025366 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LDGSGDPGGLGDWLLEGEFGQGPTGCSHVESFKVGKNWQKNLRLIYQRFVWSGTPETRKR
KAKSCICHVCSTHMNRLHSCLSCVFFGCFTEKHIHKHAETKQHHLAVDLYHGVIYCFMCK
DYVYDKDIEQIAKETKEKIFMTSGFEDKQSTCETKEQEPKLVKPKKKRRKKSVYTVGLRG
LINLGNTCFMNCIVQALTHIPLLKDFFLSDKHKCIMTSPSLCLVCEMSSLFHAMYSGSRT
PHIPYKLLHLIWIHAEHLAGYRQQDAHEFLIAILDVLHRHSKDDSGGQEANNPNCCNCII
DQIFTGGLQSDVTCQACHSVSTTIDPCWDISLDLPGSCATFDSQNPERADSTVSRDDHIP
GIPSLTDCLQWFTRPEHLGSSAKIKCNSCQSYQESTKQLTMKKLPIVACFHLKRFEHVGK
QRRKINTFISFPLELDMTPFLASTKESRMKEGQPPTDCVPNENKYSLFAVINHHGTLESG
HYTSFIRQQKDQWFSCDDAIITKATIEDLLYSEGYLLFYHKQGLEKD
Download sequence
Identical sequences ENSGGOP00000017236 ENSGGOP00000024481 ENSGGOP00000017236 ENSGGOP00000024481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]