SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024502 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024502
Domain Number 1 Region: 404-559
Classification Level Classification E-value
Superfamily Spectrin repeat 3.24e-33
Family Spectrin repeat 0.00025
Further Details:      
 
Domain Number 2 Region: 617-769
Classification Level Classification E-value
Superfamily Spectrin repeat 2.95e-32
Family Spectrin repeat 0.00052
Further Details:      
 
Domain Number 3 Region: 298-446
Classification Level Classification E-value
Superfamily Spectrin repeat 8.92e-31
Family Spectrin repeat 0.00086
Further Details:      
 
Domain Number 4 Region: 736-876
Classification Level Classification E-value
Superfamily Spectrin repeat 1.14e-28
Family Spectrin repeat 0.00058
Further Details:      
 
Domain Number 5 Region: 1217-1373
Classification Level Classification E-value
Superfamily Spectrin repeat 4.06e-28
Family Spectrin repeat 0.0016
Further Details:      
 
Domain Number 6 Region: 1642-1761
Classification Level Classification E-value
Superfamily Spectrin repeat 1.27e-27
Family Spectrin repeat 0.0000782
Further Details:      
 
Domain Number 7 Region: 88-239
Classification Level Classification E-value
Superfamily Spectrin repeat 1.82e-27
Family Spectrin repeat 0.0018
Further Details:      
 
Domain Number 8 Region: 1747-1906
Classification Level Classification E-value
Superfamily Spectrin repeat 6.28e-26
Family Spectrin repeat 0.000086
Further Details:      
 
Domain Number 9 Region: 1327-1467
Classification Level Classification E-value
Superfamily Spectrin repeat 1.68e-25
Family Spectrin repeat 0.00018
Further Details:      
 
Domain Number 10 Region: 1534-1675
Classification Level Classification E-value
Superfamily Spectrin repeat 4.94e-25
Family Spectrin repeat 0.0000715
Further Details:      
 
Domain Number 11 Region: 2018-2130
Classification Level Classification E-value
Superfamily Spectrin repeat 5.1e-24
Family Spectrin repeat 0.00068
Further Details:      
 
Domain Number 12 Region: 957-1038
Classification Level Classification E-value
Superfamily SH3-domain 1.44e-19
Family SH3-domain 0.00013
Further Details:      
 
Domain Number 13 Region: 880-944,1022-1060
Classification Level Classification E-value
Superfamily Spectrin repeat 1.19e-18
Family Spectrin repeat 0.0019
Further Details:      
 
Domain Number 14 Region: 1875-2011
Classification Level Classification E-value
Superfamily Spectrin repeat 3.27e-17
Family Spectrin repeat 0.0014
Further Details:      
 
Domain Number 15 Region: 2137-2244
Classification Level Classification E-value
Superfamily Spectrin repeat 8.38e-17
Family Spectrin repeat 0.0048
Further Details:      
 
Domain Number 16 Region: 2245-2396
Classification Level Classification E-value
Superfamily EF-hand 2.18e-16
Family Calmodulin-like 0.012
Further Details:      
 
Domain Number 17 Region: 1068-1162
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000273
Family Spectrin repeat 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024502   Gene: ENSGGOG00000000508   Transcript: ENSGGOT00000028119
Sequence length 2399
Comment pep:known_by_projection chromosome:gorGor3.1:1:137610762:137697564:-1 gene:ENSGGOG00000000508 transcript:ENSGGOT00000028119 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKFPKETVVESSGPKVLETAEEIQERRQEVLTRYQRFKERVAEKWIMEKVNILTDKSYE
DPTNIQGKYQKHQSLEAEVQTKSRLMSELEKTREERFTMGHSAHEETKAHIEELRRLWDL
LLELTLEKGDLLLRALKFQQYVQECADILEWIGDKEAIATSVELGEDWERTEVLHKKFED
FQVELVAKEGRVVEVNQYANECAEENHPDLPLIQSKQNEVNAAWERLRGLALQRQKALSN
AADLQRFKRDVTEAIQWIKEKEPVLTSEDYGKDLVASEGLFHSHKGLERNLAVMSDKKVK
ELCAKAEKLTLSHPSDAPQIQEMKEDLVSNWEHIRALATSRYEKLQATYWWYHRFSSDFD
ELSGWMNEKTAAINADELPTDVAGGEVLLDRHQQHKHEIDSYDDRFQSADETGQDLLNAN
HEASDEVREKMEILDNNWTALRELWDKRHHQYEQCLDFHLFYRDSEQVDSWMSRQEAFLE
NEDLGNSLGSAEALLQKHEDFEEAFTAQEEKITTVDKTATKLIGDDHYDSENIKAIRDGL
LARRDALREKAATRRRLLKESLLLQKLYEDSDDLKNWINKKKKLADDEDYKDIQNLKSRV
QKQQVFEKELEVNKTLLENIQKTGQEMIEHGHYASDNVTTRLSEVASLWKELMEATEQKG
TQLHEANQLLQFENNAEDLQRWLEDVEWQVTSEDYGKGLADVQNRLRKHGLLESAVAARQ
DQVDILTDLAAYFEEIGHPDSKDIRARQESLVCRFEALKEPLATRKKKLLDLLHLQMICR
DTEDEEAWIQETEPSATSSYLGKDLIASKKLLNRHRVILENIASHEPRIQEITERGNKMV
EEGHFAAEDVASRVKSLNQNMESLRARAARRQNNLEANVQFQQYLADLHEAETWIREKEP
IVDNTNYGADEEAAGALLKKHEAFLLDLNSFGDSMKALQNQANACQQQQAAPVEGAAGEQ
RVMALYDFQARGPREVTMKKGDVLTLLSSINKDWWKVEAADHQGIVPAVYVRRLAHDEFP
MLPKRRREEPGNITQRQEQIENQYRSLLDRAEERRRRLLQRYNEFLLAYEAGDMLEWIQE
KKAENTGVELDDVWELQKKFDEFQKDLNANEPRLRDINKVADDLLFEGLLTPEGAQIRQE
LNARWGSLQRLADEQRQLLGSAHAVEVFHREADDTKEQIEKKCQALSAADPGSDLFSVQA
LQRRHEGFERDLVPLGDKVTILGETAERLSESHPDATEDLQRQKMELNEAWEDLQGRTKD
CKESLNEAQKFYLFLSKARDLQNWISSIGGMVSSQELAEDLTGIEILLERHQEHRADMEA
EAPTFQALEDFSAELIDSGHHASPEIEKKLQAVKLERDDLEKAWEQRKKILDQCLELQMF
QGNCDQVESWMVARENSLRSDDKGSLDSLEALMKKRDDLDKAITAQEGKITDLEHFAERL
IADEHYAKEEIATRLQRVLDRWKALKAQLIDERTKLGDYADLKQFYRNLEELEEWISEML
PTACDESYKDPTNIQRKYLKHQTFANEVYGRSHQVDGVINLGNSLIERSACDGNEEAMKE
HLEWLKEHWVHLLERTTDKGQKLNEASRQQRFNTSIQDFEFWLSEAETLLAMKDQARDLA
SAGNLLKKHQLLETEMLAREDALKDLNTLAADLLSSGTFNVDQIMEKTDDVNKRFLNVQD
LAAAHHEKLKEAYALFQFFQDLDDEESWIEEKLIRVSSQDYGRDLQGVQNLLKKHKRLEG
ELVAHEPAIQNVLDMAEKLKDKAAVGQEEIQLRLAQFVEHWEKLKELAKARGLKLEESLE
YLQFMQNAEEEEAWINEKNALAARGDSGDTLAATQSLLMKHEALENDFAVHETRVQNVCA
QGEDILNKVLQEESQNKEISSKIEALNEKTPSLAKAIAAWKLQLEDDYVFQEFNWKADVV
EAWIADKETSLKTNGNGADLGDFLTLLAKQDALDASLQSFQQERLPEITDLKDKLIAAQH
NQSKAIEERYAALLKRWEQLLEASAVHRQKLLEKQLPLQKAEDLFMEFAHKASALNNWCE
KMEENLSEPVHCVSLNEIRQLQRDHEDFLASLAGAQADFKCLLELDQQIKALGVPSSPYT
WLTVEVLERTWKHLSDIIEEREQELQKEEARQVKNFEMCQEFEQNASTFLQWILETRAYF
LDGSLLKETGTLESQLEANKRKQKEIQAMKRQLTKIVDLGDNLEDALILDIKYSTIGLAQ
QWDQLYQLGLRMQHNLEQQIQAKDTKGVSEETLKEFSTIYKHFDENLTGRLTHKEFRSCL
RGLNYYLPMVEEDEHEPKFEKFLDAVDPGRKGYVSLEDYTAFLIDKESENIKSSDEIENA
FQALAEGKSYITKEDMKQALTPEQVSFCATHMQQYMDPRGRSHLSGYDYVGFTNSYFGN
Download sequence
Identical sequences ENSGGOP00000024502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]