SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000024511 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000024511
Domain Number 1 Region: 8-175
Classification Level Classification E-value
Superfamily EF-hand 9.4e-43
Family Calmodulin-like 0.0000638
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000024511   Gene: ENSGGOG00000012797   Transcript: ENSGGOT00000032659
Sequence length 205
Comment pep:known_by_projection chromosome:gorGor3.1:6:43402287:43425878:1 gene:ENSGGOG00000012797 transcript:ENSGGOT00000032659 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGKSVEELSSTECHQWYKKFMTECPSGQLTLYEFRQFFGLKNLSPSASQYVEQMFETFD
FNKDGYIDFMEYVAALSLVLKGKVEQKLRWYFKLYDVDGNGCIDRDELLTIIQVQRAGPG
LAIRAINPCSDSTMTAEEFTDTVFSKIDVNGDGELSLEEFIEGVQKDQMLLDTLTRSLDL
TRIVRRLQNGEQDEEGADEAAEAAG
Download sequence
Identical sequences ENSGGOP00000012477 ENSGGOP00000024511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]